Gene/Proteome Database (LMPD)

LMPD ID
LMP010758
Gene ID
819870
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
fatty acid beta-oxidation multifunctional protein MFP2
Gene Symbol
MFP2
Synonyms
ATMFP2; F3E22.20; MFP2; multifunctional protein 2; MULTIFUNCTIONAL PROTEIN 2
Alternate Names
fatty acid beta-oxidation multifunctional protein MFP2
Chromosome
3
EC Number
4.2.1.17
Summary
Encodes a multifunctional protein. Involved in peroxisomal fatty acid beta oxidation. Loss-of-function mutant lacks hydroxyacyl-CoA dehydrogenase activity and have reduced levels of long-chain enoyl-CoA hydratase activity. The mutant has fewer but larger peroxisomes.
Orthologs
View orthologs and multiple alignments for MFP2

Proteins

fatty acid beta-oxidation multifunctional protein MFP2
Refseq ID NP_187342
Protein GI 15231317
UniProt ID Q9ZPI5
mRNA ID NM_111566
Length 725
RefSeq Status REVIEWED
MDSRTKGKTVMEVGGDGVAVITLINPPVNSLSFDVLYNLKSNYEEALSRNDVKAIVITGAKGRFSGGFDISGFGEMQKGNVKEPKAGYISIDIITDLLEAARKPSVAAIDGLALGGGLELAMACHARISAPAAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMILTSKPVKAEEGHSLGLIDAVVPPAELVTTARRWALDIVGRRKPWVSSVSKTDKLPPLGEAREILTFAKAQTLKRAPNMKHPLMCLDAIEVGIVSGPRAGLEKEAEVASQVVKLDTTKGLIHVFFSQRGTAKVPGVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGIGRVKANLQSRVRKGSMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQHCILASNTSTIDLNKIGERTKSQDRIVGAHFFSPAHIMPLLEIVRTNHTSAQVIVDLLDVGKKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVECGADPYLIDRAISKFGMPMGPFRLCDLVGFGVAIATATQFIENFSERTYKSMIIPLMQEDKRAGEATRKGFYLYDDKRKAKPDPELKKYIEKARSISGVKLDPKLANLSEKDIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIMGMGFPPYRGGIMFWADSIGSKYIYSRLDEWSKAYGEFFKPCAFLAERGSKGVLLSAPVKQASSRL

Gene Information

Entrez Gene ID
819870
Gene Name
fatty acid beta-oxidation multifunctional protein MFP2
Gene Symbol
MFP2
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005618 IDA:TAIR C cell wall
GO:0009514 IEA:UniProtKB-KW C glyoxysome
GO:0005730 IDA:TAIR C nucleolus
GO:0005777 IDA:TAIR C peroxisome
GO:0009506 IDA:TAIR C plasmodesma
GO:0003857 IDA:UniProtKB F 3-hydroxyacyl-CoA dehydrogenase activity
GO:0008692 IEA:UniProtKB-EC F 3-hydroxybutyryl-CoA epimerase activity
GO:0050662 IEA:InterPro F coenzyme binding
GO:0004165 IEA:UniProtKB-EC F dodecenoyl-CoA delta-isomerase activity
GO:0004300 IEA:UniProtKB-EC F enoyl-CoA hydratase activity
GO:0016508 IDA:UniProtKB F long-chain-enoyl-CoA hydratase activity
GO:0006635 IEP:TAIR P fatty acid beta-oxidation

KEGG Pathway Links

KEGG Pathway ID Description
ath00592 alpha-Linolenic acid metabolism
ath_M00087 beta-Oxidation
ath00071 Fatty acid degradation
ath_M00113 Jasmonic acid biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR006180 3-hydroxyacyl-CoA dehydrogenase, conserved site
IPR006108 3-hydroxyacyl-CoA dehydrogenase, C-terminal
IPR006176 3-hydroxyacyl-CoA dehydrogenase, NAD binding
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like
IPR029045 ClpP/crotonase-like domain
IPR001753 Crotonase_core_superfam
IPR013328 Dehydrogenase, multihelical
IPR018376 Enoyl-CoA hydratase/isomerase, conserved site
IPR016040 NAD(P)-binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid beta-oxidation multifunctional protein MFP2
Protein Entry
MFP2_ARATH
UniProt ID
Q9ZPI5
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=240 uM for crotonyl-CoA {ECO:0000269|PubMed:10521521};
Catalytic Activity (3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl- CoA + H(2)O.
Catalytic Activity (3Z)-dodec-3-enoyl-CoA = (2E)-dodec-2-enoyl- CoA.
Catalytic Activity (S)-3-hydroxyacyl-CoA + NAD(+) = 3-oxoacyl-CoA + NADH.
Catalytic Activity (S)-3-hydroxybutanoyl-CoA = (R)-3- hydroxybutanoyl-CoA.
Developmental Stage Expression increases rapidly during seed germination to reach a peak at 2-3 days after imbibition (DAI) and then declines to basal levels at 5 DAI. {ECO:0000269|PubMed:10816107}.
Disruption Phenotype Accumulation of long-chain acyl-CoA substrates and increased size of peroxisomes. {ECO:0000269|PubMed:16507084}.
Domain The epimerase and isomerase activities are contained in the N-terminal region while the dehydrogenase activity is in the C-terminal region. {ECO:0000250}.
Function Involved in peroxisomal fatty acid beta-oxidation during seed germination. Possesses enoyl-CoA hydratase activity against long chain substrates (C14-C18) and 3-hydroxyacyl-CoA dehydrogenase activity against chains of variable sizes (C6-C18). {ECO:0000269|PubMed:10521521, ECO:0000269|PubMed:16507084, ECO:0000269|PubMed:20463021}.
Pathway Lipid metabolism; fatty acid beta-oxidation.
Similarity In the central section; belongs to the 3-hydroxyacyl- CoA dehydrogenase family. {ECO:0000305}.
Similarity In the N-terminal section; belongs to the enoyl-CoA hydratase/isomerase family. {ECO:0000305}.
Subcellular Location Glyoxysome {ECO:0000305}. Peroxisome {ECO:0000305}.
Tissue Specificity Highly expressed in senescing leaves and at lower levels in flowers and siliques. {ECO:0000269|PubMed:10816107}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010758 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15231317 RefSeq NP_187342 725 fatty acid beta-oxidation multifunctional protein MFP2

Identical Sequences to LMP010758 proteins

Reference Database Accession Length Protein Name
GI:15231317 EMBL CBG04538.1 725 unnamed protein product [Arabidopsis thaliana]
GI:15231317 EMBL CBV18060.1 725 unnamed protein product [Arabidopsis thaliana]
GI:15231317 GenBank ACW88301.1 725 Sequence 5318 from patent US 7569389
GI:15231317 GenBank AEE74468.1 725 fatty acid beta-oxidation multifunctional protein MFP2 [Arabidopsis thaliana]
GI:15231317 GenBank AGX95945.1 725 Sequence 72150 from patent US 8541208
GI:15231317 PDB 2WTB 725 Chain A, Arabidopsis Thaliana Multifuctional Protein, Mfp2

Related Sequences to LMP010758 proteins

Reference Database Accession Length Protein Name
GI:15231317 GenBank EOA29963.1 725 hypothetical protein CARUB_v10013066mg [Capsella rubella]
GI:15231317 RefSeq XP_006297065.1 725 hypothetical protein CARUB_v10013066mg [Capsella rubella]
GI:15231317 RefSeq XP_006407895.1 725 hypothetical protein EUTSA_v10020152mg [Eutrema salsugineum]
GI:15231317 RefSeq XP_010445530.1 725 PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional protein MFP2-like isoform X3 [Camelina sativa]
GI:15231317 RefSeq XP_010464276.1 725 PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 [Camelina sativa]
GI:15231317 RefSeq XP_010486216.1 725 PREDICTED: peroxisomal fatty acid beta-oxidation multifunctional protein MFP2-like [Camelina sativa]