Gene/Proteome Database (LMPD)
LMPD ID
LMP010768
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
peroxygenase 1
Gene Symbol
Synonyms
ARABIDOPSIS THALIANA PEROXYGENASE 1; ATPXG1; ATS1; CALEOSIN1; CLO1; F10M23.80; F10M23_80; seed gene 1
Alternate Names
peroxygenase 1
Chromosome
4
EC Number
1.11.2.3
Summary
Encodes caleosin, a 27-kDa protein found within seed lipid bodies. Gene is expressed preferentially in the embryo, has similarity to a rice ABA-responsive gene, EFA27. Catalyze hydroperoxide-dependent mono-oxygenation reactions. Require calcium for peroxygenase activity. Probably deeply buried in lipid droplets or microsomes.
Orthologs
Proteins
| peroxygenase 1 | |
|---|---|
| Refseq ID | NP_194404 |
| Protein GI | 15236846 |
| UniProt ID | O81270 |
| mRNA ID | NM_118808 |
| Length | 245 |
| RefSeq Status | REVIEWED |
| MGSKTEMMERDAMATVAPYAPVTYHRRARVDLDDRLPKPYMPRALQAPDREHPYGTPGHKNYGLSVLQQHVSFFDIDDNGIIYPWETYSGLRMLGFNIIGSLIIAAVINLTLSYATLPGWLPSPFFPIYIHNIHKSKHGSDSKTYDNEGRFMPVNLELIFSKYAKTLPDKLSLGELWEMTEGNRDAWDIFGWIAGKIEWGLLYLLARDEEGFLSKEAIRRCFDGSLFEYCAKIYAGISEDKTAYY | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IDA:TAIR | C | integral component of membrane |
| GO:0005811 | IEA:UniProtKB-KW | C | lipid particle |
| GO:0005509 | IDA:TAIR | F | calcium ion binding |
| GO:0004392 | IDA:TAIR | F | heme oxygenase (decyclizing) activity |
| GO:0071614 | IDA:TAIR | F | linoleic acid epoxygenase activity |
| GO:0004497 | IDA:TAIR | F | monooxygenase activity |
| GO:1990137 | IEA:UniProtKB-EC | F | plant seed peroxidase activity |
| GO:0006952 | TAS:TAIR | P | defense response |
| GO:0009793 | TAS:TAIR | P | embryo development ending in seed dormancy |
| GO:0034389 | IDA:TAIR | P | lipid particle organization |
| GO:0031408 | IDA:TAIR | P | oxylipin biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007736 | Caleosin |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | RH + ROOH = ROH + ROH. {ECO:0000269|PubMed:16956885}. |
| Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; |
| Cofactor | Name=heme b; Xref=ChEBI:CHEBI:60344; Note=Binds 1 heme b (iron(II)-protoporphyrin IX) group.; |
| Developmental Stage | Expressed during the early-to-late cotyledon stage of seed maturation. {ECO:0000269|PubMed:10380802, ECO:0000269|PubMed:11197322}. |
| Disruption Phenotype | No visible phenotype, but retarded growth during the first 48 hours after germination. {ECO:0000269|PubMed:16961733}. |
| Domain | The proline-knot motif (118-127) may be involved in targeting to lipid bodies. |
| Domain | Transmembrane regions are predicted by sequence analysis tools, but these regions probably constitute hydrophobic domains associated to phospholipids. |
| Enzyme Regulation | Inhibited by beta-mercaptoethanol and the organophosphorothioate terbufos. {ECO:0000269|PubMed:16956885}. |
| Function | Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination and in the oxylipin signaling pathways and plant defense responses. Can catalyze sulfoxidation of thiobenzamide, hydroxylation of aniline, epoxidation of oleic acid or intramolecular oxygen transfer. {ECO:0000269|PubMed:16961733}. |
| Induction | Not induced by abscisic acid or osmotic stress. {ECO:0000269|PubMed:11197322}. |
| Ptm | Phosphorylated. Partially phosphorylated at Ser-225, but not phosphorylated at Ser-72, Tyr-145, Thr-166 or Ser-172. Phosphorylation is not required for catalytic activity. {ECO:0000269|PubMed:17582382}. |
| Similarity | Belongs to the caleosin family. {ECO:0000305}. |
| Similarity | Contains 1 EF-hand domain. {ECO:0000305}. |
| Subcellular Location | Microsome membrane {ECO:0000269|PubMed:11197322}. Lipid droplet {ECO:0000269|PubMed:11197322}. |
| Subunit | Homodimer. {ECO:0000269|PubMed:16956885, ECO:0000269|PubMed:17582382}. |
| Tissue Specificity | Expressed in seeds. Expression restricted to the developing embryo with enhanced expression in both the protoderm and vasculature. Detected in root tip cells throughout development. {ECO:0000269|PubMed:10380802, ECO:0000269|PubMed:11197322}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010768 (as displayed in Record Overview)
Identical Sequences to LMP010768 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15236846 | EMBL | CAW35327.1 | 245 | unnamed protein product [Arabidopsis thaliana] |
| GI:15236846 | EMBL | CAW44113.1 | 245 | unnamed protein product [Arabidopsis thaliana] |
| GI:15236846 | EMBL | CBC01361.1 | 245 | unnamed protein product [Arabidopsis thaliana] |
| GI:15236846 | EMBL | CBC09622.1 | 245 | unnamed protein product [Arabidopsis thaliana] |
| GI:15236846 | GenBank | AEE85247.1 | 245 | peroxygenase 1 [Arabidopsis thaliana] |
| GI:15236846 | SwissProt | O81270.1 | 245 | RecName: Full=Peroxygenase 1; Short=AtPXG1; AltName: Full=Caleosin-1; AltName: Full=Embryo-specific protein 1 (ATS1) [Arabidopsis thaliana] |
Related Sequences to LMP010768 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15236846 | EMBL | CAW35354.1 | 245 | unnamed protein product [Arabidopsis thaliana] |
| GI:15236846 | EMBL | CAW44143.1 | 245 | unnamed protein product [Arabidopsis thaliana] |
| GI:15236846 | GenBank | AAV19405.1 | 850 | Sequence 42 from patent US 6753167 |
| GI:15236846 | GenBank | ADF14242.1 | 850 | Sequence 42 from patent US 7666628 |
| GI:15236846 | GenBank | EFH43803.1 | 245 | hypothetical protein ARALYDRAFT_329010 [Arabidopsis lyrata subsp. lyrata] |
| GI:15236846 | RefSeq | XP_002867544.1 | 245 | hypothetical protein ARALYDRAFT_329010 [Arabidopsis lyrata subsp. lyrata] |