Gene/Proteome Database (LMPD)
LMPD ID
LMP010811
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phosphatidylinositol N-acetylglucosaminyltransferase subunit P
Gene Symbol
Synonyms
T1F9.23; T1F9_23
Alternate Names
phosphatidylinositol N-acetylglucosaminyltransferase subunit P
Chromosome
1
EC Number
2.4.1.198
Proteins
| phosphatidylinositol N-acetylglucosaminyltransferase subunit P | |
|---|---|
| Refseq ID | NP_176323 |
| Protein GI | 15219898 |
| UniProt ID | O64792 |
| mRNA ID | NM_104809 |
| Length | 137 |
| RefSeq Status | REVIEWED |
| MLSLNQEVHGPKTSEVYGFVGSISIVVATVIFLIWGYVPDKFLESIGIYYYPSKYWAMAMPMYSMVTLLVALVFYIGLNFMSTSKPTSLNTLFDDYSREDVNFLPLMKNGEDRPIDPISDIDITRINDLMFDSHLAK | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol N-acetylglucosaminyltransferase subunit P
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0017176 | IEA:UniProtKB-EC | F | phosphatidylinositol N-acetylglucosaminyltransferase activity |
| GO:0006506 | IEA:UniProtKB-UniPathway | P | GPI anchor biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| ko00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| ath01100 | Metabolic pathways |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 6253955 | Synthesis of glycosylphosphatidylinositol (GPI) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol N-acetylglucosaminyltransferase subunit P
Protein Entry
PIGP_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | UDP-N-acetyl-D-glucosamine + 1-phosphatidyl- 1D-myo-inositol = UDP + 6-(N-acetyl-alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol. |
| Function | Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. {ECO:0000250}. |
| Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
| Similarity | Belongs to the PIGP family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010811 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15219898 | RefSeq | NP_176323 | 137 | phosphatidylinositol N-acetylglucosaminyltransferase subunit P |
Identical Sequences to LMP010811 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15219898 | GenBank | AAC13913.1 | 137 | T1F9.23 [Arabidopsis thaliana] |
| GI:15219898 | GenBank | ABR46238.1 | 137 | At1g61280 [Arabidopsis thaliana] |
| GI:15219898 | GenBank | AEE33816.1 | 137 | phosphatidylinositol N-acetylglucosaminyltransferase subunit P [Arabidopsis thaliana] |
| GI:15219898 | SwissProt | O64792.1 | 137 | RecName: Full=Phosphatidylinositol N-acetylglucosaminyltransferase subunit P [Arabidopsis thaliana] |
Related Sequences to LMP010811 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15219898 | GenBank | EFH64353.1 | 155 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15219898 | GenBank | AEC09678.1 | 181 | phosphatidylinositol N-acetylglucosaminyltransferase, GPI19/PIG-P subunit [Arabidopsis thaliana] |
| GI:15219898 | GenBank | ESQ52625.1 | 167 | hypothetical protein EUTSA_v10017327mg [Eutrema salsugineum] |
| GI:15219898 | RefSeq | NP_001118477.4 | 181 | phosphatidylinositol N-acetylglucosaminyltransferase, GPI19/PIG-P subunit [Arabidopsis thaliana] |
| GI:15219898 | RefSeq | XP_002888094.1 | 155 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15219898 | RefSeq | XP_006411172.1 | 167 | hypothetical protein EUTSA_v10017327mg [Eutrema salsugineum] |