Gene/Proteome Database (LMPD)

LMPD ID
LMP010828
Gene ID
844425
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phospholipid N-methyltransferase
Gene Symbol
PLMT
Synonyms
ARABIDOPSIS PHOSPHOLIPID N-METHYLTRANSFERASE; ATPLMT; F23A5.21; F23A5_21; phospholipid N-methyltransferase; PLMT
Alternate Names
phospholipid N-methyltransferase
Chromosome
1
EC Number
2.1.1.71
Summary
Encodes a single-copy phospholipid N-methyltransferase, involved in phosphatidylcholine biosynthesis. Has specific activity towards phosphatidylmonomethylethanolamine and phosphatidyldimethylethanolamine, but not phosphatidylethanolamine.
Orthologs
View orthologs and multiple alignments for PLMT

Proteins

phospholipid N-methyltransferase
Refseq ID NP_565246
Protein GI 18412906
UniProt ID Q9SAH5
mRNA ID NM_106734
Length 164
RefSeq Status REVIEWED
MGLLAAIGVLLPFPFYWWLWTNAQSWVNLCGRERDPSTVMARVSHVLKAAQLLSLFSVASLSWPPPLYFWPLMAFGQFLNFRVYQLLGEAGTYYGVRFGKNIPWVTEFPFGVIRDPQYVGSIMSLLACLSWVPFQYILLWSLGYVFMMFLESKEDPNARAKSIS
phospholipid N-methyltransferase
Refseq ID NP_849916
Protein GI 42570261
UniProt ID Q9SAH5
mRNA ID NM_179585
Length 164
RefSeq Status REVIEWED
Protein sequence is identical to GI:18412906 (mRNA isoform)

Gene Information

Entrez Gene ID
844425
Gene Name
phospholipid N-methyltransferase
Gene Symbol
PLMT
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043231 IDA:TAIR C intracellular membrane-bounded organelle
GO:0080101 IDA:TAIR F phosphatidyl-N-dimethylethanolamine N-methyltransferase activity
GO:0000773 IDA:TAIR F phosphatidyl-N-methylethanolamine N-methyltransferase activity
GO:0006656 IEA:UniProtKB-UniPathway P phosphatidylcholine biosynthetic process
GO:0008654 IMP:TAIR P phospholipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00564 Glycerophospholipid metabolism
ath01100 Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY4FS-4 phosphatidylcholine biosynthesis IV
PWY4FS-5 superpathway of phosphatidylcholine biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR024960 Phosphatidyl-N-methylethanolamine/N-methyltransferase
IPR007318 Phospholipid methyltransferase

UniProt Annotations

Entry Information

Gene Name
phospholipid N-methyltransferase
Protein Entry
PLMT_ARATH
UniProt ID
Q9SAH5
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity S-adenosyl-L-methionine + phosphatidyl-N- dimethylethanolamine = S-adenosyl-L-homocysteine + phosphatidylcholine.
Catalytic Activity S-adenosyl-L-methionine + phosphatidyl-N- methylethanolamine = S-adenosyl-L-homocysteine + phosphatidyl-N- dimethylethanolamine.
Disruption Phenotype No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:19366698}.
Function Catalyzes the S-adenosylmethionine-dependent methylation of ethanolamine-containing phospholipids to produce the abundant membrane lipid phosphatidylcholine (PtdCho). However, in a heterologous yeast expression system, Arabidopsis and soybean PLMTs methylate phosphatidyl-N-methylethanolamine and phosphatidyl-N-dimethylethanolamine but cannot utilize phosphatidylethanolamine as a substrate. {ECO:0000269|PubMed:19366698}.
Pathway Phospholipid metabolism; phosphatidylcholine biosynthesis.
Sequence Caution Sequence=BAC43303.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Similarity Belongs to the class VI-like SAM-binding methyltransferase superfamily. PEMT/PEM2 methyltransferase family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010828 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18412906 RefSeq NP_565246 164 phospholipid N-methyltransferase

Identical Sequences to LMP010828 proteins

Reference Database Accession Length Protein Name
GI:18412906 GenBank AAF14673.1 164 ESTs gb|AI994515 and gb|T44237 come from this gene [Arabidopsis thaliana]
GI:18412906 GenBank ACF88498.1 164 At1g80860 [Arabidopsis thaliana]
GI:18412906 GenBank AEE36459.1 164 phospholipid N-methyltransferase [Arabidopsis thaliana]
GI:18412906 GenBank AEE36460.1 164 phospholipid N-methyltransferase [Arabidopsis thaliana]
GI:18412906 RefSeq NP_849916.2 164 phospholipid N-methyltransferase [Arabidopsis thaliana]
GI:18412906 SwissProt Q9SAH5.1 164 RecName: Full=Phosphatidyl-N-methylethanolamine N-methyltransferase; AltName: Full=Phospholipid N-methyltransferase; Short=AtPLMT [Arabidopsis thaliana]

Related Sequences to LMP010828 proteins

Reference Database Accession Length Protein Name
GI:18412906 GenBank AAM65699.1 164 unknown [Arabidopsis thaliana]
GI:18412906 GenBank EFH64066.1 163 N-methyltransferase [Arabidopsis lyrata subsp. lyrata]
GI:18412906 RefSeq XP_002887807.1 163 N-methyltransferase [Arabidopsis lyrata subsp. lyrata]
GI:18412906 RefSeq XP_010417655.1 165 PREDICTED: phosphatidyl-N-methylethanolamine N-methyltransferase [Camelina sativa]
GI:18412906 RefSeq XP_010429894.1 164 PREDICTED: phosphatidyl-N-methylethanolamine N-methyltransferase-like [Camelina sativa]
GI:18412906 RefSeq XP_010472864.1 164 PREDICTED: phosphatidyl-N-methylethanolamine N-methyltransferase [Camelina sativa]