Gene/Proteome Database (LMPD)
LMPD ID
LMP010856
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phospholipase A(1) DAD1
Gene Symbol
Synonyms
DEFECTIVE ANTHER DEHISCENCE 1; F16B22.45
Alternate Names
phospholipase A(1) DAD1
Chromosome
2
EC Number
3.1.1.32
Summary
Mutant has defects in anther dehiscence, pollen maturation, and flower opening. The DAD1 protein is a chloroplastic phospholipase A1 that catalyzes the initial step of jasmonic acid biosynthesis.
Orthologs
Proteins
| phospholipase A(1) DAD1 | |
|---|---|
| Refseq ID | NP_182008 |
| Protein GI | 15224963 |
| UniProt ID | Q948R1 |
| mRNA ID | NM_130045 |
| Length | 357 |
| RefSeq Status | REVIEWED |
| MEYQGLQNWDGLLDPLDDNLRREILRYGQFVESAYQAFDFDPSSPTYGTCRFPRSTLLERSGLPNSGYRLTKNLRATSGINLPRWIEKAPSWMATQSSWIGYVAVCQDKEEISRLGRRDVVISFRGTATCLEWLENLRATLTHLPNGPTGANLNGSNSGPMVESGFLSLYTSGVHSLRDMVREEIARLLQSYGDEPLSVTITGHSLGAAIATLAAYDIKTTFKRAPMVTVISFGGPRVGNRCFRKLLEKQGTKVLRIVNSDDVITKVPGVVLENREQDNVKMTASIMPSWIQRRVEETPWVYAEIGKELRLSSRDSPHLSSINVATCHELKTYLHLVDGFVSSTCPFRETARRVLHR | |
Gene Information
Entrez Gene ID
Gene Name
phospholipase A(1) DAD1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IEA:UniProtKB-KW | C | chloroplast |
| GO:0052740 | IEA:UniProtKB-EC | F | 1-acyl-2-lysophosphatidylserine acylhydrolase activity |
| GO:0008970 | IEA:UniProtKB-EC | F | phosphatidylcholine 1-acylhydrolase activity |
| GO:0052739 | IEA:UniProtKB-EC | F | phosphatidylserine 1-acylhydrolase activity |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath00564 | Glycerophospholipid metabolism |
| ath01100 | Metabolic pathways |
| ath00592 | alpha-Linolenic acid metabolism |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| LIPASYN-PWY | phospholipases |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | pH dependence: Optimum pH is 6.0-6.5. {ECO:0000269|PubMed:11595796}; |
| Catalytic Activity | Phosphatidylcholine + H(2)O = 2- acylglycerophosphocholine + a carboxylate. {ECO:0000269|PubMed:11595796, ECO:0000269|PubMed:19527719}. |
| Disruption Phenotype | Defective in anther dehiscence and pollen maturation. Delayed flower buds opening. {ECO:0000269|PubMed:11595796}. |
| Function | Sn-1-specific phospholipase that releases free fatty acids from phospholipids. Low activity on galactolipids and triacylglycerols. Catalyzes the initial step of jasmonic acid biosynthesis. Not essential for jasmonate biosynthesis after wounding or upon pathogen infection. {ECO:0000269|PubMed:11595796, ECO:0000269|PubMed:18267087, ECO:0000269|PubMed:20348210}. |
| Induction | By wounding. {ECO:0000269|PubMed:11595796, ECO:0000269|PubMed:18267087, ECO:0000269|PubMed:20348210}. |
| Miscellaneous | Directly regulated at the transcription level by the floral homeotic gene AGAMOUS. |
| Sequence Caution | Sequence=AAC31843.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=AAL69449.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=AAM14879.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=AEC10469.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; |
| Similarity | Belongs to the AB hydrolase superfamily. Lipase family. {ECO:0000305}. |
| Subcellular Location | Plastid, chloroplast {ECO:0000269|PubMed:11595796, ECO:0000269|PubMed:18267087, ECO:0000269|PubMed:19527719}. |
| Tissue Specificity | Expressed in flower buds, but not in leaves or roots. Restricted to the stamen filaments immediately before flower opening. {ECO:0000269|PubMed:11595796, ECO:0000269|PubMed:18267087, ECO:0000269|PubMed:19527719}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010856 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15224963 | RefSeq | NP_182008 | 357 | phospholipase A(1) DAD1 |
Identical Sequences to LMP010856 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15224963 | EMBL | CAW83604.1 | 357 | unnamed protein product [Arabidopsis thaliana] |
| GI:15224963 | EMBL | CBC12273.1 | 357 | unnamed protein product [Arabidopsis thaliana] |
| GI:15224963 | EMBL | CBD29176.1 | 357 | unnamed protein product [Arabidopsis thaliana] |
| GI:15224963 | EMBL | CBC90587.1 | 357 | unnamed protein product [Arabidopsis thaliana] |
| GI:15224963 | EMBL | CBC85660.1 | 357 | unnamed protein product [Arabidopsis thaliana] |
| GI:15224963 | GenBank | AEC10469.1 | 357 | phospholipase A(1) DAD1 [Arabidopsis thaliana] |
Related Sequences to LMP010856 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15224963 | EMBL | CAW83624.1 | 447 | unnamed protein product [Arabidopsis thaliana] |
| GI:15224963 | EMBL | CBC12293.1 | 447 | unnamed protein product [Arabidopsis thaliana] |
| GI:15224963 | EMBL | CBD29196.1 | 447 | unnamed protein product [Arabidopsis thaliana] |
| GI:15224963 | EMBL | CBC90627.1 | 447 | unnamed protein product [Arabidopsis thaliana] |
| GI:15224963 | EMBL | CBC85699.1 | 447 | unnamed protein product [Arabidopsis thaliana] |
| GI:15224963 | SwissProt | Q948R1.1 | 447 | RecName: Full=Phospholipase A(1) DAD1, chloroplastic; AltName: Full=Phospholipase A1-Ibeta1; AltName: Full=Protein DEFECTIVE IN ANTHER DEHISCENCE 1; Short=AtDAD1; Flags: Precursor [Arabidopsis thaliana] |