Gene/Proteome Database (LMPD)

LMPD ID
LMP010869
Gene ID
829067
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phospholipase A2-gamma
Gene Symbol
AT4G29460
Synonyms
F17A13.280; F17A13_280
Alternate Names
phospholipase A2-gamma
Chromosome
4
EC Number
3.1.1.4

Proteins

phospholipase A2-gamma
Refseq ID NP_194675
Protein GI 15233578
UniProt ID Q9M0D7
mRNA ID NM_119091
Length 187
RefSeq Status REVIEWED
MITGLALSRVAFGLTAFLLLAVVSSQEKCSNTCIAQNCNSLGIRYGKYCGIGYFGCPGEPPCDDLDACCMTHDNCVDLKGMTYVNCHKQFKRCVNKLSKSIKHSNGEKIGFSTQCPYSIVIPTVFNGMDYGIFFSGIGNIFNPPVLGSVPVVEVDLARSKVDTKDGLGTKLGLQTKEGSKVSASLNI

Gene Information

Entrez Gene ID
829067
Gene Name
phospholipase A2-gamma
Gene Symbol
AT4G29460
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:TAIR C Golgi apparatus
GO:0005783 IDA:TAIR C endoplasmic reticulum
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0005509 IEA:InterPro F calcium ion binding
GO:0004623 IDA:UniProtKB F phospholipase A2 activity
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0006644 IEA:InterPro P phospholipid metabolic process
GO:0009555 IMP:TAIR P pollen development
GO:0009846 IDA:UniProtKB P pollen germination
GO:0009860 IDA:UniProtKB P pollen tube growth

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6803 phosphatidylcholine acyl editing
LIPASYN-PWY phospholipases
LIPASYN-PWY phospholipases

Domain Information

InterPro Annotations

Accession Description
IPR001211 Phospholipase A2
IPR016090 Phospholipase A2 domain
IPR013090 Phospholipase A2, active site

UniProt Annotations

Entry Information

Gene Name
phospholipase A2-gamma
Protein Entry
PLA2C_ARATH
UniProt ID
Q9M0D7
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO:0000255|PROSITE- ProRule:PRU10035, ECO:0000269|PubMed:14550557}.
Cofactor Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Note=Binds 1 Ca(2+) ion per subunit.;
Developmental Stage Expressed during pollen germination and tube growth. {ECO:0000269|PubMed:21278126}.
Function PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Releases lysophospholipids (LPLs) and free fatty acids (FFAs) from membrane phospholipids in response to hormones and other external stimuli. Plays a role in pollen development and germination and tube growth. {ECO:0000269|PubMed:14550557, ECO:0000269|PubMed:21278126}.
Miscellaneous The enzyme has a slight preference for phosphatidylethanolamine over phosphatidylcholine.
Similarity Belongs to the phospholipase A2 family. {ECO:0000305}.
Subcellular Location Secreted. Golgi apparatus, trans-Golgi network. Endoplasmic reticulum.
Tissue Specificity Strongly expressed in mature flowers but weakly expressed in other tissues. Detected in buds, open flowers and in pollen. {ECO:0000269|PubMed:14550557, ECO:0000269|PubMed:15748654, ECO:0000269|PubMed:21278126}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010869 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15233578 RefSeq NP_194675 187 phospholipase A2-gamma

Identical Sequences to LMP010869 proteins

Reference Database Accession Length Protein Name
GI:15233578 EMBL CAB79704.1 187 phospholipase A2-like protein [Arabidopsis thaliana]
GI:15233578 GenBank AAN63044.1 187 phospholipase A2 gamma [Arabidopsis thaliana]
GI:15233578 GenBank AEE85634.1 187 phospholipase A2-gamma [Arabidopsis thaliana]
GI:15233578 SwissProt Q9M0D7.1 187 RecName: Full=Phospholipase A2-gamma; AltName: Full=Secretory phospholipase A2-gamma; Short=AtsPLA2-gamma; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010869 proteins

Reference Database Accession Length Protein Name
GI:15233578 GenBank EFH43665.1 187 phospholipase A2 gamma, secretory low molecular weight [Arabidopsis lyrata subsp. lyrata]
GI:15233578 GenBank ESQ54290.1 186 hypothetical protein EUTSA_v10026920mg [Eutrema salsugineum]
GI:15233578 RefSeq XP_002867406.1 187 phospholipase A2 gamma, secretory low molecular weight [Arabidopsis lyrata subsp. lyrata]
GI:15233578 RefSeq XP_006412837.1 186 hypothetical protein EUTSA_v10026920mg [Eutrema salsugineum]
GI:15233578 RefSeq XP_010433095.1 193 PREDICTED: phospholipase A2-gamma-like [Camelina sativa]
GI:15233578 RefSeq XP_010447851.1 192 PREDICTED: phospholipase A2-gamma-like [Camelina sativa]