Gene/Proteome Database (LMPD)

LMPD ID
LMP010915
Gene ID
836234
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
plasmodesmata callose-binding protein 1
Gene Symbol
PDCB1
Synonyms
MAF19.13; MAF19_13; PDCB1; plasmodesmata callose-binding protein 1
Alternate Names
plasmodesmata callose-binding protein 1
Chromosome
5

Proteins

plasmodesmata callose-binding protein 1
Refseq ID NP_200921
Protein GI 30697478
UniProt ID Q9FNQ2
mRNA ID NM_125506
Length 201
RefSeq Status REVIEWED
MAALVLSLLLLSLAGHSSASWCVCKTGLSDTVLQATLDYACGNGADCNPTKPKQSCFNPDNVRSHCNYAVNSFFQKKGQSPGSCNFDGTATPTNSDPSYTGCAFPTSASGSSGSTTVTPGTTNPKGSPTTTTLPGSGTNSPYSGNPTNGVFGGNSTGGTTGTGINPDYTTDSSAFALKNSSKLFICLLLIASSGFCSFLML

Gene Information

Entrez Gene ID
836234
Gene Name
plasmodesmata callose-binding protein 1
Gene Symbol
PDCB1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031225 TAS:TAIR C anchored component of membrane
GO:0046658 IDA:TAIR C anchored component of plasma membrane
GO:0009505 IDA:TAIR C plant-type cell wall
GO:0005886 IDA:TAIR C plasma membrane
GO:0009506 IDA:TAIR C plasmodesma
GO:0001872 IDA:TAIR F (1->3)-beta-D-glucan binding
GO:0030247 IDA:TAIR F polysaccharide binding
GO:0052543 IMP:TAIR P callose deposition in cell wall

Domain Information

InterPro Annotations

Accession Description
IPR012946 X8 domain

UniProt Annotations

Entry Information

Gene Name
plasmodesmata callose-binding protein 1
Protein Entry
PDCB1_ARATH
UniProt ID
Q9FNQ2
Species
Arabidopsis

Comments

Comment Type Description
Function Able to bind (1->3)-beta-D-glucans (laminarin). Probably involved in cell-to-cell trafficking regulation. {ECO:0000269|PubMed:19223515}.
Miscellaneous Overexpression of PDCB1 results in callose accumulation and decreased plasmodesmal molecular diffusion.
Ptm Contains two additional disulfide bonds. {ECO:0000250}.
Subcellular Location Cell membrane {ECO:0000269|PubMed:19223515}; Lipid-anchor, GPI-anchor {ECO:0000269|PubMed:19223515}. Cell junction, plasmodesma {ECO:0000269|PubMed:19223515}.
Tissue Specificity Expressed in the shoot apical region and in young leaves but also detected in the laminar and vasculature of mature leaves. {ECO:0000269|PubMed:19223515}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010915 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
30697478 RefSeq NP_200921 201 plasmodesmata callose-binding protein 1

Identical Sequences to LMP010915 proteins

Reference Database Accession Length Protein Name
GI:30697478 DBBJ BAB10375.1 201 unnamed protein product [Arabidopsis thaliana]
GI:30697478 GenBank AAO41925.1 201 putative glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
GI:30697478 GenBank AAO50728.1 201 putative glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
GI:30697478 gnl TAIR 201 plasmodesmata callose-binding protein 1 [Arabidopsis thaliana]
GI:30697478 SwissProt Q9FNQ2.1 201 RecName: Full=PLASMODESMATA CALLOSE-BINDING PROTEIN 1; Short=AtPDCB1; AltName: Full=Glucan endo-1,3-beta-glucosidase-like protein 2; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010915 proteins

Reference Database Accession Length Protein Name
GI:30697478 GenBank EFH42678.1 201 hypothetical protein ARALYDRAFT_919353 [Arabidopsis lyrata subsp. lyrata]
GI:30697478 GenBank EOA14034.1 198 hypothetical protein CARUB_v10027167mg [Capsella rubella]
GI:30697478 GenBank KFK27882.1 204 hypothetical protein AALP_AA8G441900 [Arabis alpina]
GI:30697478 RefSeq XP_002866419.1 201 hypothetical protein ARALYDRAFT_919353 [Arabidopsis lyrata subsp. lyrata]
GI:30697478 RefSeq XP_006281136.1 198 hypothetical protein CARUB_v10027167mg [Capsella rubella]
GI:30697478 RefSeq XP_010456989.1 203 PREDICTED: PLASMODESMATA CALLOSE-BINDING PROTEIN 1-like isoform X2 [Camelina sativa]