Gene/Proteome Database (LMPD)

LMPD ID
LMP010941
Gene ID
816152
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
putative polyprenol reductase 2
Gene Symbol
AT2G16530
Synonyms
F1P15.9; F1P15_9
Alternate Names
putative polyprenol reductase 2
Chromosome
2
EC Number
1.3.1.94

Proteins

putative polyprenol reductase 2
Refseq ID NP_973474
Protein GI 42570801
UniProt ID Q9SI62
mRNA ID NM_201745
Length 342
RefSeq Status REVIEWED
MVELEIVWLVRGAWITVWIVSILPLVIASIPTSKLNSFRELVLSFAGRGKILHPSSQFTIPQKCFAHFYVIGVVWTTLLLAATWMYACKMAPLSSEEFQLSDIASRLAGGSDVFSVHKSNMTPVEHRFKVWRAVFLLLLMEIHVLRRLIESFYVFKYSPSARMHILGYFAGLFFYVTAPLSLCSNIAPEVAGFVGNQVAEFIANGKSHTSAPEFNLLSSISPLMKLGSLQWIGGAIFLWGWIHQRRCHAILGSLRENPSQAKEYIIPYGDWFGMVSSPHFLAEIVLYAGLLIASGGTDITIWLLFGFVAANLTYAAGETHRWYLRKFENYPANRHAIFPYVY
putative polyprenol reductase 2
Refseq ID NP_565389
Protein GI 18398148
UniProt ID Q9SI62
mRNA ID NM_127207
Length 343
RefSeq Status REVIEWED
MVELEIVWLVRGAWITVWIVSILPLVIASIPTSKLNSFRELVLSFAGRGKILHPSSQKFTIPQKCFAHFYVIGVVWTTLLLAATWMYACKMAPLSSEEFQLSDIASRLAGGSDVFSVHKSNMTPVEHRFKVWRAVFLLLLMEIHVLRRLIESFYVFKYSPSARMHILGYFAGLFFYVTAPLSLCSNIAPEVAGFVGNQVAEFIANGKSHTSAPEFNLLSSISPLMKLGSLQWIGGAIFLWGWIHQRRCHAILGSLRENPSQAKEYIIPYGDWFGMVSSPHFLAEIVLYAGLLIASGGTDITIWLLFGFVAANLTYAAGETHRWYLRKFENYPANRHAIFPYVY

Gene Information

Entrez Gene ID
816152
Gene Name
putative polyprenol reductase 2
Gene Symbol
AT2G16530
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:TAIR C Golgi apparatus
GO:0005783 IDA:TAIR C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016627 IEA:InterPro F oxidoreductase activity, acting on the CH-CH group of donors
GO:0006629 IEA:InterPro P lipid metabolic process
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation

REACTOME Pathway Links

REACTOME Pathway ID Description
6254049 Androgen biosynthesis
6254047 Metabolism of steroid hormones and vitamin D
6254037 Synthesis of Dolichyl-phosphate
6254038 Synthesis of substrates in N-glycan biosythesis

Domain Information

InterPro Annotations

Accession Description
IPR001104 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal

UniProt Annotations

Entry Information

Gene Name
putative polyprenol reductase 2
Protein Entry
POED2_ARATH
UniProt ID
Q9SI62
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9SI62-1; Sequence=Displayed; Name=2; IsoId=Q9SI62-2; Sequence=VSP_039793; Note=No experimental confirmation available.;
Catalytic Activity Ditrans,polycis-dolichol + NADP(+) = ditrans,polycis-polyprenol + NADPH.
Function Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism (By similarity). {ECO:0000250}.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010941 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18398148 RefSeq NP_565389 343 putative polyprenol reductase 2
42570801 RefSeq NP_973474 342 putative polyprenol reductase 2

Identical Sequences to LMP010941 proteins

Reference Database Accession Length Protein Name
GI:18398148 GenBank AEC06507.1 343 putative polyprenol reductase 2 [Arabidopsis thaliana]
GI:42570801 GenBank AEC06508.1 342 putative polyprenol reductase 2 [Arabidopsis thaliana]
GI:18398148 gnl TIGR 343 expressed protein [Arabidopsis thaliana]
GI:18398148 SwissProt Q9SI62.2 343 RecName: Full=Polyprenol reductase 2 [Arabidopsis thaliana]

Related Sequences to LMP010941 proteins

Reference Database Accession Length Protein Name
GI:42570801 GenBank AAK96489.1 343 At2g16530/F1P15.9 [Arabidopsis thaliana]
GI:18398148 GenBank AAK96489.1 343 At2g16530/F1P15.9 [Arabidopsis thaliana]
GI:18398148 GenBank AAO11632.1 343 At2g16530/F1P15.9 [Arabidopsis thaliana]
GI:42570801 GenBank AAO11632.1 343 At2g16530/F1P15.9 [Arabidopsis thaliana]
GI:18398148 GenBank EFH49022.1 342 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Arabidopsis lyrata subsp. lyrata]
GI:42570801 GenBank AEC06507.1 343 putative polyprenol reductase 2 [Arabidopsis thaliana]
GI:18398148 GenBank AEC06508.1 342 putative polyprenol reductase 2 [Arabidopsis thaliana]
GI:42570801 gnl TIGR 343 expressed protein [Arabidopsis thaliana]
GI:42570801 RefSeq NP_565389.1 343 putative polyprenol reductase 2 [Arabidopsis thaliana]
GI:18398148 RefSeq NP_973474.1 342 putative polyprenol reductase 2 [Arabidopsis thaliana]
GI:18398148 RefSeq XP_002872763.1 342 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Arabidopsis lyrata subsp. lyrata]
GI:42570801 SwissProt Q9SI62.2 343 RecName: Full=Polyprenol reductase 2 [Arabidopsis thaliana]