Gene/Proteome Database (LMPD)
LMPD ID
LMP010950
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
Gene Symbol
Synonyms
T16L4.50; T16L4_50
Alternate Names
probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
Chromosome
4
EC Number
2.3.1.129
Proteins
probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | |
---|---|
Refseq ID | NP_194683 |
Protein GI | 30688366 |
UniProt ID | Q9SU91 |
mRNA ID | NM_119099 |
Length | 334 |
RefSeq Status | REVIEWED |
MISLLKAREKLLSPLVSSTIRRLSSSLSYSREDSRDSEVLIHPSAVVHPNAVIGKGVSVGPYCTIGSSVKLGNGCKLYPSSHVFGNTELGESCVLMTGAVVGDELPGYTFIGCNNIIGHHAVVGVKCQDLKYKHGDECFLCIGNNNEIREFCSIHRSSKPSDKTVIGDNNLIMGSCHIAHDCKIGDRNIFANNTLLAGHVVVEDNTHTAGASVVHQFCHIGSFAFIGGGSVVSQDVPKYMMVAGERAELRGLNLEGLRRNGFTMSEMKSLRAAYRKIFMSTETVSLSFEERLTELDQELYSVPAVSAMLQSIRDSFTESRRGICKFRQWLDSTT |
probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | |
---|---|
Refseq ID | NP_001031749 |
Protein GI | 79325527 |
UniProt ID | Q9SU91 |
mRNA ID | NM_001036672 |
Length | 336 |
RefSeq Status | REVIEWED |
MISLLKAREKLLSPLVSSTIRRLSSSLSYSREDSRDSEVLIHPSAVVHPNAVIGKGVSVGPYCTIGSSVKLGNGCKLYPSSHVFGNTELGESCVLMTGAVVGDELPGYTFIGCNNIIGHHAVVGVKCQDLKYKHGDECFLCIGNNNEIREFCSIHRSSKPSDKTVIGDNNLIMGSCHIAHDCKIGDRNIFANNTLLAGHVVVEDNTHTAGASVVHQFCHIGSFAFIGGGSVVSQDVPKYMMVAGERAELRGLNLEGLRRNGFTMSEMKSLRAAYRKIFMSTETVSLSFEERLTELEQDQELYSVPAVSAMLQSIRDSFTESRRGICKFRQWLDSTT |
Gene Information
Entrez Gene ID
Gene Name
probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IDA:TAIR | C | mitochondrion |
GO:0008780 | IDA:TAIR | F | acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase activity |
GO:0009245 | IEA:UniProtKB-KW | P | lipid A biosynthetic process |
GO:2001289 | IMP:TAIR | P | lipid X metabolic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ath01100 | Metabolic pathways |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
NAGLIPASYN-PWY | lipid IVA biosynthesis |
KDO-NAGLIPASYN-PWY | superpathway of (KDO)2-lipid A biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
Protein Entry
LPXA_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9SU91-1; Sequence=Displayed; Name=2; IsoId=Q9SU91-2; Sequence=VSP_045743; Note=No experimental confirmation available.; |
Catalytic Activity | (R)-3-hydroxytetradecanoyl-[acyl-carrier- protein] + UDP-N-acetyl-alpha-D-glucosamine = [acyl-carrier- protein] + UDP-3-O-(3-hydroxytetradecanoyl)-N-acetyl-alpha-D- glucosamine. {ECO:0000269|PubMed:22545860}. |
Disruption Phenotype | No visible phenotype under normal growth conditions, but plants lacking LPXA accumulate very low levels of 2,3-diacylglucosamine-1-phosphate. {ECO:0000269|PubMed:21709257}. |
Function | Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that in bacteria anchors the lipopolysaccharide to the outer membrane of the cell. Lipid A-like molecules in plants may serve as structural components of the outer membranes of mitochondria and/or chloroplasts, or may be involved in signal transduction or plant defense responses (Potential). {ECO:0000305}. |
Pathway | Glycolipid biosynthesis; lipid IV(A) biosynthesis; lipid IV(A) from (3R)-3-hydroxytetradecanoyl-[acyl-carrier-protein] and UDP-N-acetyl-alpha-D-glucosamine: step 1/6. {ECO:0000269|PubMed:21709257}. |
Similarity | Belongs to the transferase hexapeptide repeat family. LpxA subfamily. {ECO:0000305}. |
Subcellular Location | Mitochondrion {ECO:0000269|PubMed:21709257}. |
Subunit | Homotrimer. {ECO:0000269|PubMed:22545860}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010950 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
79325527 | RefSeq | NP_001031749 | 336 | probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase |
30688366 | RefSeq | NP_194683 | 334 | probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase |
Identical Sequences to LMP010950 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:79325527 | DBBJ | BAD43226.1 | 336 | UDP-N-acetylglucosamine O-acyltransferase - like protein [Arabidopsis thaliana] |
GI:79325527 | EMBL | CAB45314.1 | 336 | UDP-N-acetylglucosamine O-acyltransferase-like protein [Arabidopsis thaliana] |
GI:79325527 | EMBL | CAB79712.1 | 336 | UDP-N-acetylglucosamine O-acyltransferase-like protein [Arabidopsis thaliana] |
GI:30688366 | GenBank | AAN13071.1 | 334 | putative UDP-N-acetylglucosamine O-acyltransferase [Arabidopsis thaliana] |
GI:30688366 | GenBank | AEE85641.1 | 334 | probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase [Arabidopsis thaliana] |
GI:79325527 | GenBank | AEE85642.1 | 336 | probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase [Arabidopsis thaliana] |
GI:79325527 | SwissProt | Q9SU91.1 | 336 | RecName: Full=Probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial; Short=UDP-N-acetylglucosamine acyltransferase; AltName: Full=Protein LIPID X A; Short=AtLpxA; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010950 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:30688366 | DBBJ | BAD43226.1 | 336 | UDP-N-acetylglucosamine O-acyltransferase - like protein [Arabidopsis thaliana] |
GI:30688366 | EMBL | CAB45314.1 | 336 | UDP-N-acetylglucosamine O-acyltransferase-like protein [Arabidopsis thaliana] |
GI:30688366 | EMBL | CAB79712.1 | 336 | UDP-N-acetylglucosamine O-acyltransferase-like protein [Arabidopsis thaliana] |
GI:79325527 | GenBank | AAN13071.1 | 334 | putative UDP-N-acetylglucosamine O-acyltransferase [Arabidopsis thaliana] |
GI:79325527 | GenBank | EFH45686.1 | 336 | acyl--UDP-N-acetylglucosamine O-acyltransferase [Arabidopsis lyrata subsp. lyrata] |
GI:79325527 | GenBank | AEE85641.1 | 334 | probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase [Arabidopsis thaliana] |
GI:30688366 | GenBank | AEE85642.1 | 336 | probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase [Arabidopsis thaliana] |
GI:79325527 | GenBank | EOA15562.1 | 334 | hypothetical protein CARUB_v10005206mg [Capsella rubella] |
GI:79325527 | RefSeq | NP_194683.2 | 334 | probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase [Arabidopsis thaliana] |
GI:30688366 | RefSeq | NP_001031749.1 | 336 | probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase [Arabidopsis thaliana] |
GI:79325527 | RefSeq | XP_002869427.1 | 336 | acyl--UDP-N-acetylglucosamine O-acyltransferase [Arabidopsis lyrata subsp. lyrata] |
GI:30688366 | SwissProt | Q9SU91.1 | 336 | RecName: Full=Probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial; Short=UDP-N-acetylglucosamine acyltransferase; AltName: Full=Protein LIPID X A; Short=AtLpxA; Flags: Precursor [Arabidopsis thaliana] |