Gene/Proteome Database (LMPD)
LMPD ID
LMP010978
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
fatty acyl-CoA reductase 4
Gene Symbol
Synonyms
fatty acid reductase 4
Alternate Names
fatty acyl-CoA reductase 4
Chromosome
3
EC Number
1.2.1.n2
Summary
Encodes a member of the eight-member gene family encoding alcohol-forming fatty acyl-CoA reductases (FARs) identified in Arabidopsis thaliana. Three of the FARs, FAR1 (At5g22500), FAR4 (At3g44540) and FAR5 (At3g44550), are shown to generate the fatty alcohols found in root, seed coat, and wound-induced leaf tissue.
Orthologs
Proteins
fatty acyl-CoA reductase 4 | |
---|---|
Refseq ID | NP_190040 |
Protein GI | 79432534 |
UniProt ID | Q9LXN3 |
mRNA ID | NM_114322 |
Length | 493 |
RefSeq Status | REVIEWED |
MDSNCIQFLHDKTILVTGVPGFLAKVFVEKILRIQPKVKKLFLLLRAADNESAMQRFHSEVLEKDLFRVLKNALGDENLKAFITEKVVPIPGDISVDNLGVKGSDLLQHMWNEIDIIVNVAATTNFDERYDVGLSVNTFGPLNVLNFAKKCVKGQLLLHVSTAYVRGEKSGLLHEKTFHMGETLNGHRKLVIETEMELMKQKLKELQKQNCSEEEISQSMKDLGMSRAKLHGWPNTYVFTKSMGEMLLGNYRENLPIVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLADPNSVLDLIPVDMVANAMVTAAAIHAGKLGSQTVYHVGSSCKNPITFEQIHDLAASYFTKNPLVRRDGSSILVSKGTILSTMAQFSFYMTLRYKLPLQMLRLIYVIYPWWNGNKYKDIDRKIKLAMRLVDLYRPYVLFKGIFDDTNTEKLRLKRKEINKEMYGLFEFDPKSIDWEDYMTTIHIPGLITYVLKK |
fatty acyl-CoA reductase 4 | |
---|---|
Refseq ID | NP_001030809 |
Protein GI | 79314181 |
UniProt ID | Q9LXN3 |
mRNA ID | NM_001035732 |
Length | 433 |
RefSeq Status | REVIEWED |
MDSNCIQFLHDKTILVTGVPGFLAKVFVEKILRIQPKVKKLFLLLRAADNESAMQRFHSEVLEKDLFRVLKNALGDENLKAFITEKVVPIPGDISVDNLGVKGSDLLQHMWNEIDIIVNVAATTNFDERYDVGLSVNTFGPLNVLNFAKKCVKGQLLLHVSTAYVRGEKSGLLHEKTFHMGETLNGHRKLVIETEMELMKQKLKELQKQNCSEEEISQSMKDLGMSRAKLHGWPNTYVFTKSMGEMLLGNYRENLPIVIIRPTMITSTFSEPFPGWIEGLRTIDSVIVAYGKGRLKCFLADPNSVLDLIPVDMVANAMVTAAAIHAGKLGSQTVYHVGSSCKNPITFEQIHDLAASYFTKNPLVRRDGSSILVSKGTILSTMAQFSFYMTLRYKLPLQTLTARLSWRCGWSTSTDLMSCLRAYLTIRILRNCG |
Gene Information
Entrez Gene ID
Gene Name
fatty acyl-CoA reductase 4
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0080019 | IEA:InterPro | F | fatty-acyl-CoA reductase (alcohol-forming) activity |
GO:0050062 | IDA:TAIR | F | long-chain-fatty-acyl-CoA reductase activity |
GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
GO:0009651 | IEP:TAIR | P | response to salt stress |
GO:0009611 | IMP:TAIR | P | response to wounding |
GO:0010345 | IMP:TAIR | P | suberin biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ath00073 | Cutin, suberine and wax biosynthesis |
ath04146 | Peroxisome |
ko04146 | Peroxisome |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
6254165 | Plasmalogen biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
fatty acyl-CoA reductase 4
Protein Entry
FACR4_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9LXN3-1; Sequence=Displayed; Note=Derived from EST data. No experimental confirmation available.; Name=2; IsoId=Q9LXN3-2; Sequence=VSP_037566, VSP_037567; |
Catalytic Activity | Hexadecanal + CoA + NADP(+) = hexadecanoyl-CoA + NADPH. |
Function | Catalyzes the reduction of fatty acyl-CoA to fatty alcohols. {ECO:0000250}. |
Similarity | Belongs to the fatty acyl-CoA reductase family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010978 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
79432534 | RefSeq | NP_190040 | 493 | fatty acyl-CoA reductase 4 |
79314181 | RefSeq | NP_001030809 | 433 | fatty acyl-CoA reductase 4 |
Identical Sequences to LMP010978 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:79314181 | DBBJ | BAE99400.1 | 433 | acyl CoA reductase - protein [Arabidopsis thaliana] |
GI:79432534 | EMBL | CAB88536.1 | 493 | acyl CoA reductase-protein [Arabidopsis thaliana] |
GI:79314181 | GenBank | ACF22894.1 | 433 | At3g44540 [Arabidopsis thaliana] |
GI:79432534 | GenBank | ACX17748.1 | 493 | Sequence 45336 from patent US 7569389 |
GI:79432534 | GenBank | AEE77912.1 | 493 | fatty acid reductase 4 [Arabidopsis thaliana] |
GI:79314181 | GenBank | AEE77913.1 | 433 | fatty acid reductase 4 [Arabidopsis thaliana] |
GI:79432534 | SwissProt | Q9LXN3.1 | 493 | RecName: Full=Probable fatty acyl-CoA reductase 4 [Arabidopsis thaliana] |
Related Sequences to LMP010978 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:79314181 | EMBL | CAB88536.1 | 493 | acyl CoA reductase-protein [Arabidopsis thaliana] |
GI:79314181 | GenBank | ACX17748.1 | 493 | Sequence 45336 from patent US 7569389 |
GI:79432534 | GenBank | ACX21298.1 | 489 | Sequence 50130 from patent US 7569389 |
GI:79432534 | GenBank | EFH51930.1 | 493 | oxidoreductase, acting on the CH-CH group of donors [Arabidopsis lyrata subsp. lyrata] |
GI:79314181 | GenBank | AEE77912.1 | 493 | fatty acid reductase 4 [Arabidopsis thaliana] |
GI:79432534 | GenBank | EOA12263.1 | 493 | hypothetical protein CARUB_v10007993mg [Capsella rubella] |
GI:79432534 | GenBank | EOA23870.1 | 493 | hypothetical protein CARUB_v10017087mg [Capsella rubella] |
GI:79314181 | RefSeq | NP_190040.3 | 493 | fatty acyl-CoA reductase 4 [Arabidopsis thaliana] |
GI:79432534 | RefSeq | XP_002875671.1 | 493 | oxidoreductase, acting on the CH-CH group of donors [Arabidopsis lyrata subsp. lyrata] |
GI:79432534 | RefSeq | XP_006290972.1 | 493 | hypothetical protein CARUB_v10017087mg [Capsella rubella] |
GI:79314181 | RefSeq | XP_010514784.1 | 433 | PREDICTED: probable fatty acyl-CoA reductase 4 isoform X2 [Camelina sativa] |
GI:79314181 | SwissProt | Q9LXN3.1 | 493 | RecName: Full=Probable fatty acyl-CoA reductase 4 [Arabidopsis thaliana] |