Gene/Proteome Database (LMPD)

LMPD ID
LMP010981
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
putative sn-glycerol-3-phosphate 2-O-acyltransferase
Gene Symbol
Synonyms
ATGPAT3; glycerol-3-phosphate acyltransferase 3; GPAT3; T7B11.21; T7B11_21
Alternate Names
putative sn-glycerol-3-phosphate 2-O-acyltransferase
Chromosome
4
EC Number
2.3.1.15
Summary
Encodes a member of a family of proteins with glycerol-3-phosphate acyltransferase activity.
Orthologs

Proteins

putative sn-glycerol-3-phosphate 2-O-acyltransferase
Refseq ID NP_192104
Protein GI 15235185
UniProt ID Q9SYJ2
mRNA ID NM_116426
Length 520
RefSeq Status REVIEWED
MSAKISIFQALVFLFYRFILRRYRNSKPKYQNGPSSLLQSDLSRHTLIFNVEGALLKSDSLFPYFMLVAFEAGGVIRSFLLFILYPLISLMSHEMGVKVMVMVSFFGIKKEGFRAGRAVLPKYFLEDVGLEMFEVLKRGGKKIGVSDDLPQVMIEGFLRDYLEIDVVVGREMKVVGGYYLGIMEDKTKHDLVFDELVRKERLNTGRVIGITSFNTSLHRYLFSQFCQEIYFVKKSDKRSWQTLPRSQYPKPLIFHDGRLAIKPTLMNTLVLFMWGPFAAAAAAARLFVSLCIPYSLSIPILAFSGCRLTVTNDYVSSQKQKPSQRKGCLFVCNHRTLLDPLYVAFALRKKNIKTVTYSLSRVSEILAPIKTVRLTRDRVSDGQAMEKLLTEGDLVVCPEGTTCREPYLLRFSPLFTEVSDVIVPVAVTVHVTFFYGTTASGLKALDPLFFLLDPYPTYTIQFLDPVSGATCQDPDGKLKFEVANNVQSDIGKALDFECTSLTRKDKYLILAGNNGVVKKN

Gene Information

Entrez Gene ID
Gene Name
putative sn-glycerol-3-phosphate 2-O-acyltransferase
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0004366 IEA:UniProtKB-EC F glycerol-3-phosphate O-acyltransferase activity
GO:0016024 IEA:UniProtKB-UniPathway P CDP-diacylglycerol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00561 Glycerolipid metabolism
ath00564 Glycerophospholipid metabolism
ath01100 Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY4FS-8 phosphatidylglycerol biosynthesis II (non-plastidic)

Domain Information

InterPro Annotations

Accession Description
IPR002123 Phospholipid/glycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
putative sn-glycerol-3-phosphate 2-O-acyltransferase
Protein Entry
GPAT3_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + sn-glycerol 3-phosphate = CoA + 1- acyl-sn-glycerol 3-phosphate.
Domain The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. {ECO:0000250}.
Function Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis. {ECO:0000250}.
Pathway Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 1/3.
Similarity Belongs to the GPAT/DAPAT family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.
Tissue Specificity Widely expressed at low level. Expressed at higher level in seedlings and leaves. {ECO:0000269|PubMed:12897259}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010981 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15235185 RefSeq NP_192104 520 putative sn-glycerol-3-phosphate 2-O-acyltransferase

Identical Sequences to LMP010981 proteins

Reference Database Accession Length Protein Name
GI:15235185 EMBL CAB80688.1 520 predicted protein of unknown function [Arabidopsis thaliana]
GI:15235185 GenBank AAD22657.1 520 predicted protein of unknown function [Arabidopsis thaliana]
GI:15235185 GenBank AAM19774.1 520 AT4g01950/T7B11_21 [Arabidopsis thaliana]
GI:15235185 GenBank AAN31103.1 520 At4g01950/T7B11_21 [Arabidopsis thaliana]
GI:15235185 GenBank AEE82104.1 520 putative sn-glycerol-3-phosphate 2-O-acyltransferase [Arabidopsis thaliana]
GI:15235185 SwissProt Q9SYJ2.1 520 RecName: Full=Probable glycerol-3-phosphate acyltransferase 3; Short=AtGPAT3 [Arabidopsis thaliana]

Related Sequences to LMP010981 proteins

Reference Database Accession Length Protein Name
GI:15235185 GenBank EFH49127.1 520 glycerol-3-phosphate acyltransferase 3 [Arabidopsis lyrata subsp. lyrata]
GI:15235185 GenBank EOA20349.1 540 hypothetical protein CARUB_v10000657mg [Capsella rubella]
GI:15235185 RefSeq XP_002872868.1 520 glycerol-3-phosphate acyltransferase 3 [Arabidopsis lyrata subsp. lyrata]
GI:15235185 RefSeq XP_006287451.1 540 hypothetical protein CARUB_v10000657mg [Capsella rubella]
GI:15235185 RefSeq XP_010456102.1 520 PREDICTED: probable glycerol-3-phosphate acyltransferase 3 isoform X2 [Camelina sativa]
GI:15235185 RefSeq XP_010456103.1 520 PREDICTED: probable glycerol-3-phosphate acyltransferase 3 isoform X3 [Camelina sativa]