Gene/Proteome Database (LMPD)
Proteins
putative long-chain-alcohol O-fatty-acyltransferase 2 | |
---|---|
Refseq ID | NP_200348 |
Protein GI | 15240499 |
UniProt ID | Q9FJ73 |
mRNA ID | NM_124919 |
Length | 343 |
RefSeq Status | REVIEWED |
MEEELRNLIKVWISALISISYCYYISSKISKGVLRLLSLLPIFIIFLLLPLFFSSVHFCVISGFFFTWLANFKLFLFAFDQEPLSPLPSNLTRFFCFACFPIKINKNPSSNRIHNKPMSKWVLAFKLLIFSFLLHVYRNNYDSGLSRFAFLALFTIHVYLEAELILVFVGALMSMLLGCEMEPVFNDPYLATSLQEFWSRRWNLMVPAVLRPAVHIPVQRFCAPLLGLHRAFYAGMLATFIVSGLMHELIYFYVIRKSPTWEVTCFFLLHGVVTCLEIAMKRMRWLPTPRRAVSGLAITVFLLVTAGWLFYPQMLRNDVHKRVISECLLVIDVVKRHVVCILM |
Gene Information
Entrez Gene ID
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 2
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0047196 | IEA:UniProtKB-EC | F | long-chain-alcohol O-fatty-acyltransferase activity |
GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
BIOCYC Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR017088 | Wax synthase |
UniProt Annotations
Entry Information
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 2
Protein Entry
WAXS2_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester. |
Function | Catalyzes the final step in the synthesis of long-chain linear esters (waxes). {ECO:0000250}. |
Similarity | Belongs to the wax synthase family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010997 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15240499 | RefSeq | NP_200348 | 343 | putative long-chain-alcohol O-fatty-acyltransferase 2 |
Identical Sequences to LMP010997 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15240499 | DBBJ | BAB08554.1 | 343 | wax synthase-like protein [Arabidopsis thaliana] |
GI:15240499 | GenBank | ACW86219.1 | 343 | Sequence 2468 from patent US 7569389 |
GI:15240499 | gnl | TAIR | 343 | putative long-chain-alcohol O-fatty-acyltransferase 2 [Arabidopsis thaliana] |
GI:15240499 | SwissProt | Q9FJ73.1 | 343 | RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 2; AltName: Full=Wax synthase 2 [Arabidopsis thaliana] |
Related Sequences to LMP010997 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15240499 | GenBank | ACC06869.1 | 356 | Sequence 6 from patent US 7332311 |
GI:15240499 | GenBank | EOA13659.1 | 341 | hypothetical protein CARUB_v10026728mg [Capsella rubella] |
GI:15240499 | RefSeq | XP_006280761.1 | 341 | hypothetical protein CARUB_v10026728mg [Capsella rubella] |
GI:15240499 | RefSeq | XP_010449511.1 | 342 | PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 2 isoform X1 [Camelina sativa] |
GI:15240499 | RefSeq | XP_010443159.1 | 346 | PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 2 [Camelina sativa] |
GI:15240499 | RefSeq | XP_010482977.1 | 342 | PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 2 [Camelina sativa] |