Gene/Proteome Database (LMPD)
Proteins
putative S-acyltransferase | |
---|---|
Refseq ID | NP_567193 |
Protein GI | 79458493 |
UniProt ID | Q5M757 |
mRNA ID | NM_116310 |
Length | 291 |
RefSeq Status | REVIEWED |
MNLFRFCSGLKVLGYFMILLVVAVVGVSYYAVVVSTWWPILIRGDHGALSALAALIIFVFHFLLIMLLWSYFTTVFTDPGSVPEHFRREMGGGDSLEAGTSTDQGAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTFLETMLDVIVLLPSFIEFFSQAIKHSSSPGKLASLVLAFVLNFAFVLSLLCFVVMHISLLSSNTTSVEVHEKNGEVRWKYDLGKKKNFEQVFGKKKAFWLLPLYSKDDIDNITSLEGLEFPTCSDIDP |
Gene Information
Entrez Gene ID
Gene Name
putative S-acyltransferase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
putative S-acyltransferase
Protein Entry
ZDH15_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
Domain | The DHHC domain is required for palmitoyltransferase activity. {ECO:0000250}. |
Function | Palmitoyl acyltransferase. {ECO:0000250}. |
Sequence Caution | Sequence=AAB62854.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAB80893.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
Similarity | Belongs to the DHHC palmitoyltransferase family. {ECO:0000305}. |
Similarity | Contains 1 DHHC-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00067}. |
Subcellular Location | Cell membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011028 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
79458493 | RefSeq | NP_567193 | 291 | putative S-acyltransferase |
Identical Sequences to LMP011028 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:79458493 | DBBJ | BAF01156.1 | 291 | hypothetical protein [Arabidopsis thaliana] |
GI:79458493 | GenBank | AAV91337.1 | 291 | At4g00840 [Arabidopsis thaliana] |
GI:79458493 | GenBank | AAW39012.1 | 291 | At4g00840 [Arabidopsis thaliana] |
GI:79458493 | GenBank | AEE81944.1 | 291 | putative S-acyltransferase [Arabidopsis thaliana] |
GI:79458493 | SwissProt | Q5M757.1 | 291 | RecName: Full=Probable protein S-acyltransferase 12; AltName: Full=Probable palmitoyltransferase At4g00840; AltName: Full=Zinc finger DHHC domain-containing protein At4g00840 [Arabidopsis thaliana] |
Related Sequences to LMP011028 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:79458493 | GenBank | EFH49185.1 | 291 | zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] |
GI:79458493 | GenBank | EOA21264.1 | 291 | hypothetical protein CARUB_v10001614mg [Capsella rubella] |
GI:79458493 | RefSeq | XP_002872926.1 | 291 | zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] |
GI:79458493 | RefSeq | XP_006288366.1 | 291 | hypothetical protein CARUB_v10001614mg [Capsella rubella] |
GI:79458493 | RefSeq | XP_010422733.1 | 291 | PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa] |
GI:79458493 | RefSeq | XP_010456165.1 | 291 | PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa] |