Gene/Proteome Database (LMPD)
Proteins
DHHC-type zinc finger family protein | |
---|---|
Refseq ID | NP_191639 |
Protein GI | 22331887 |
UniProt ID | Q8VYP5 |
mRNA ID | NM_115944 |
Length | 307 |
RefSeq Status | REVIEWED |
MHRSGTTMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALSQGGLDSLAALTILILFHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLNSLDFVGLQSDSSSSNPRVRFCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTTTIEAYEKKTTTKWRYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDSQ |
Gene Information
Entrez Gene ID
Gene Name
DHHC-type zinc finger family protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IDA:TAIR | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
DHHC-type zinc finger family protein
Protein Entry
ZDH14_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
Domain | The DHHC domain is required for palmitoyltransferase activity. {ECO:0000250}. |
Function | Palmitoyl acyltransferase. {ECO:0000250}. |
Sequence Caution | Sequence=CAB82684.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
Similarity | Belongs to the DHHC palmitoyltransferase family. {ECO:0000305}. |
Similarity | Contains 1 DHHC-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00067}. |
Subcellular Location | Golgi apparatus, trans-Golgi network membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011029 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
22331887 | RefSeq | NP_191639 | 307 | DHHC-type zinc finger family protein |
Identical Sequences to LMP011029 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:22331887 | DBBJ | BAF01138.1 | 307 | hypothetical protein [Arabidopsis thaliana] |
GI:22331887 | GenBank | AAL49877.1 | 307 | unknown protein [Arabidopsis thaliana] |
GI:22331887 | GenBank | AAM20224.1 | 307 | unknown protein [Arabidopsis thaliana] |
GI:22331887 | GenBank | AEE80109.1 | 307 | DHHC-type zinc finger family protein [Arabidopsis thaliana] |
GI:22331887 | SwissProt | Q8VYP5.1 | 307 | RecName: Full=Probable protein S-acyltransferase 14; AltName: Full=Probable palmitoyltransferase At3g60800; AltName: Full=Zinc finger DHHC domain-containing protein At3g60800 [Arabidopsis thaliana] |
Related Sequences to LMP011029 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:22331887 | GenBank | AEL85138.1 | 307 | Sequence 755 from patent US 7989676 |
GI:22331887 | GenBank | AFA60536.1 | 307 | Sequence 1239 from patent US 8088975 |
GI:22331887 | GenBank | AFD40849.1 | 307 | Sequence 200 from patent US 8124839 |
GI:22331887 | GenBank | AFX28279.1 | 307 | Sequence 9339 from patent US 8299318 |
GI:22331887 | GenBank | AFX48913.1 | 307 | Sequence 50746 from patent US 8299318 |
GI:22331887 | GenBank | AGF15184.1 | 307 | Sequence 14603 from patent US 8362325 |