Gene/Proteome Database (LMPD)

LMPD ID
LMP011029
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
DHHC-type zinc finger family protein
Gene Symbol
Alternate Names
DHHC-type zinc finger family protein
Chromosome
3
EC Number
2.3.1.225

Proteins

DHHC-type zinc finger family protein
Refseq ID NP_191639
Protein GI 22331887
UniProt ID Q8VYP5
mRNA ID NM_115944
Length 307
RefSeq Status REVIEWED
MHRSGTTMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALSQGGLDSLAALTILILFHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLNSLDFVGLQSDSSSSNPRVRFCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTTTIEAYEKKTTTKWRYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDSQ

Gene Information

Entrez Gene ID
Gene Name
DHHC-type zinc finger family protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:TAIR C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0019706 IEA:UniProtKB-EC F protein-cysteine S-palmitoyltransferase activity
GO:0008270 IEA:InterPro F zinc ion binding

Domain Information

InterPro Annotations

Accession Description
IPR001594 Zinc finger, DHHC-type, palmitoyltransferase

UniProt Annotations

Entry Information

Gene Name
DHHC-type zinc finger family protein
Protein Entry
ZDH14_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
Domain The DHHC domain is required for palmitoyltransferase activity. {ECO:0000250}.
Function Palmitoyl acyltransferase. {ECO:0000250}.
Sequence Caution Sequence=CAB82684.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the DHHC palmitoyltransferase family. {ECO:0000305}.
Similarity Contains 1 DHHC-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00067}.
Subcellular Location Golgi apparatus, trans-Golgi network membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011029 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22331887 RefSeq NP_191639 307 DHHC-type zinc finger family protein

Identical Sequences to LMP011029 proteins

Reference Database Accession Length Protein Name
GI:22331887 DBBJ BAF01138.1 307 hypothetical protein [Arabidopsis thaliana]
GI:22331887 GenBank AAL49877.1 307 unknown protein [Arabidopsis thaliana]
GI:22331887 GenBank AAM20224.1 307 unknown protein [Arabidopsis thaliana]
GI:22331887 GenBank AEE80109.1 307 DHHC-type zinc finger family protein [Arabidopsis thaliana]
GI:22331887 SwissProt Q8VYP5.1 307 RecName: Full=Probable protein S-acyltransferase 14; AltName: Full=Probable palmitoyltransferase At3g60800; AltName: Full=Zinc finger DHHC domain-containing protein At3g60800 [Arabidopsis thaliana]

Related Sequences to LMP011029 proteins

Reference Database Accession Length Protein Name
GI:22331887 GenBank AEL85138.1 307 Sequence 755 from patent US 7989676
GI:22331887 GenBank AFA60536.1 307 Sequence 1239 from patent US 8088975
GI:22331887 GenBank AFD40849.1 307 Sequence 200 from patent US 8124839
GI:22331887 GenBank AFX28279.1 307 Sequence 9339 from patent US 8299318
GI:22331887 GenBank AFX48913.1 307 Sequence 50746 from patent US 8299318
GI:22331887 GenBank AGF15184.1 307 Sequence 14603 from patent US 8362325