Gene/Proteome Database (LMPD)
Proteins
| DHHC-type zinc finger family protein | |
|---|---|
| Refseq ID | NP_196126 |
| Protein GI | 79507162 |
| UniProt ID | Q5PNZ1 |
| mRNA ID | NM_120589 |
| Length | 413 |
| RefSeq Status | REVIEWED |
| MQRERMSKKKISQVHCIPSGDHILMTASSSKHIPHIRFYKAWKGNNRFCCGGRLIFGPDVSSLYLTSFLIGAPALTFCIRMLVWIKRGDPFFNYTVLASGFILTLLDFTFLMLTSARDPGIIPRNKTSMILEDDSDSSLTQSMEWVNNKTPNLKIPRTKDVFVNGYTIKVKFCDTCLLYRPPRASHCSICNNCVQRFDHHCPWVGQCIARRNYPFFICFISSSTLLCIYVFVFSWINLIRQPGKLWRTMSDDIVSVILIVYTFVAVWFVGGLTIFHFYLMSTNQTTYENFRYRYDKKENPYKRGLLKNVKEVLFAKIPPSQLDLRAMVPEEDDMTIASNDSEYESEYTSSVRYDTEMGGKLIKRDSPRKLPLPTRNLDDIKDISDNYDRSTTTREDASDRDPSFFSSQLDLPK | |
Gene Information
Entrez Gene ID
Gene Name
DHHC-type zinc finger family protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031410 | IEA:UniProtKB-KW | C | cytoplasmic vesicle |
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
DHHC-type zinc finger family protein
Protein Entry
ZDH21_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. {ECO:0000250}. |
| Function | Palmitoyl acyltransferase. {ECO:0000250}. |
| Sequence Caution | Sequence=BAB11529.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the DHHC palmitoyltransferase family. {ECO:0000305}. |
| Similarity | Contains 1 DHHC-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00067}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. Cytoplasmic vesicle membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Tissue Specificity | Expressed in flowers and pollen. {ECO:0000269|PubMed:22968831}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011038 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 79507162 | RefSeq | NP_196126 | 413 | DHHC-type zinc finger family protein |
Identical Sequences to LMP011038 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:79507162 | GenBank | AAV85661.1 | 413 | At5g05070 [Arabidopsis thaliana] |
| GI:79507162 | GenBank | ACW88871.1 | 413 | Sequence 6090 from patent US 7569389 |
| GI:79507162 | GenBank | ACX20777.1 | 413 | Sequence 49425 from patent US 7569389 |
| GI:79507162 | gnl | TAIR | 413 | DHHC-type zinc finger family protein [Arabidopsis thaliana] |
| GI:79507162 | SwissProt | Q5PNZ1.1 | 413 | RecName: Full=Probable protein S-acyltransferase 3; AltName: Full=Probable palmitoyltransferase At5g05070; AltName: Full=Zinc finger DHHC domain-containing protein At5g05070 [Arabidopsis thaliana] |
Related Sequences to LMP011038 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:79507162 | GenBank | ACW88872.1 | 408 | Sequence 6091 from patent US 7569389 |
| GI:79507162 | GenBank | ACW88873.1 | 389 | Sequence 6092 from patent US 7569389 |
| GI:79507162 | GenBank | ACX20778.1 | 408 | Sequence 49426 from patent US 7569389 |
| GI:79507162 | GenBank | ACX20779.1 | 389 | Sequence 49427 from patent US 7569389 |
| GI:79507162 | GenBank | EFH47392.1 | 413 | zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] |
| GI:79507162 | RefSeq | XP_002871133.1 | 413 | zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] |