Gene/Proteome Database (LMPD)

LMPD ID
LMP011089
Gene ID
836213
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
glycosylphosphatidylinositol-anchored protein COBRA
Gene Symbol
COB
Synonyms
COBRA; MSL3.40; MSL3_40
Alternate Names
glycosylphosphatidylinositol-anchored protein COBRA
Chromosome
5

Proteins

glycosylphosphatidylinositol-anchored protein COBRA
Refseq ID NP_568930
Protein GI 18424412
UniProt ID Q94KT8
mRNA ID NM_125485
Length 456
RefSeq Status REVIEWED
MESFFSRSTSIVSKLSFLALWIVFLISSSSFTSTEAYDALDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIQSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWVQDPATAASSFQISVGAAGTTNKTVRVPRNFTLMGPGPGYTCGPAKIVRPTKFVTTDTRRTTQAMMTWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTCACGCQNNRTESGACLDPDTPHLASVVSPPTKKGTVLPPLVQCTRHMCPIRVHWHVKQNYKEYWRVKITITNFNYRLNYTQWNLVAQHPNLDNITQIFSFNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGNVQSEILFRKDQSTFTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPNGGSRSQFSFVAAVLLPLLVFFFFSA

Gene Information

Entrez Gene ID
836213
Gene Name
glycosylphosphatidylinositol-anchored protein COBRA
Gene Symbol
COB
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031225 TAS:TAIR C anchored component of membrane
GO:0046658 IDA:TAIR C anchored component of plasma membrane
GO:0009897 ISS:TAIR C external side of plasma membrane
GO:0009930 IDA:TAIR C longitudinal side of cell surface
GO:0009505 IDA:TAIR C plant-type cell wall
GO:0005886 IDA:TAIR C plasma membrane
GO:0010215 IMP:TAIR P cellulose microfibril organization
GO:0009825 IMP:TAIR P multidimensional cell growth
GO:0009651 IMP:TAIR P response to salt stress

Domain Information

InterPro Annotations

Accession Description
IPR006918 COBRA, plant

UniProt Annotations

Entry Information

Gene Name
glycosylphosphatidylinositol-anchored protein COBRA
Protein Entry
COBRA_ARATH
UniProt ID
Q94KT8
Species
Arabidopsis

Comments

Comment Type Description
Function Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition. May act by recruiting cellulose synthesizing complexes to discrete positions on the cell surface.
Miscellaneous A partial protein missing the N-terminal signal peptide was reported to complement a yeast mutant defective in phytochelatin synthesis. It is therefore possible that COBRA binds divalent metals.
Sequence Caution Sequence=BAB10641.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAA07251.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the COBRA family. {ECO:0000305}.
Subcellular Location Lateral cell membrane {ECO:0000305|PubMed:11331607}; Lipid-anchor, GPI-anchor {ECO:0000305|PubMed:11331607}; Extracellular side {ECO:0000305|PubMed:11331607}. Note=Located on the longitudinal sides of the cell rather than on the apical or basal sides.
Tissue Specificity Expressed in roots, stems, leaves, flowers and siliques. Up-regulated in the root zone of rapid longitudinal expansion. {ECO:0000269|PubMed:11331607, ECO:0000269|PubMed:12376623}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011089 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18424412 RefSeq NP_568930 456 glycosylphosphatidylinositol-anchored protein COBRA

Identical Sequences to LMP011089 proteins

Reference Database Accession Length Protein Name
GI:18424412 GenBank ACH17605.1 456 Sequence 356 from patent US 7402667
GI:18424412 GenBank ACW87828.1 456 Sequence 4675 from patent US 7569389
GI:18424412 GenBank ACW97699.1 456 Sequence 18069 from patent US 7569389
GI:18424412 GenBank ACW98311.1 456 Sequence 18906 from patent US 7569389
GI:18424412 GenBank AFX49523.1 456 Sequence 51356 from patent US 8299318
GI:18424412 gnl TAIR 456 glycosylphosphatidylinositol-anchored protein COBRA [Arabidopsis thaliana]

Related Sequences to LMP011089 proteins

Reference Database Accession Length Protein Name
GI:18424412 GenBank AAM62930.1 456 phytochelatin synthetase-like protein [Arabidopsis thaliana]
GI:18424412 GenBank EFH42663.1 456 hypothetical protein ARALYDRAFT_496244 [Arabidopsis lyrata subsp. lyrata]
GI:18424412 GenBank AEL85087.1 456 Sequence 670 from patent US 7989676
GI:18424412 GenBank EOA13179.1 537 hypothetical protein CARUB_v10026206mg, partial [Capsella rubella]
GI:18424412 RefSeq XP_002866404.1 456 hypothetical protein ARALYDRAFT_496244 [Arabidopsis lyrata subsp. lyrata]
GI:18424412 RefSeq XP_006280281.1 537 hypothetical protein CARUB_v10026206mg, partial [Capsella rubella]