Gene/Proteome Database (LMPD)

LMPD ID
LMP011090
Gene ID
828553
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
fatty acid elongation machinery component ECERIFERUM2
Gene Symbol
CER2
Synonyms
ECERIFERUM 2; F22K18.290; F22K18_290; VC-2; VC2
Alternate Names
fatty acid elongation machinery component ECERIFERUM2
Chromosome
4
Summary
Involved in C28 to C30 fatty acid elongation.
Orthologs
View orthologs and multiple alignments for CER2

Proteins

fatty acid elongation machinery component ECERIFERUM2
Refseq ID NP_194182
Protein GI 15233851
UniProt ID Q39048
mRNA ID NM_118584
Length 421
RefSeq Status REVIEWED
MEGSPVTSVRLSSVVPASVVGENKPRQLTPMDLAMKLHYVRAVYFFKGARDFTVADVKNTMFTLQSLLQSYHHVSGRIRMSDNDNDTSAAAIPYIRCNDSGIRVVEANVEEFTVEKWLELDDRSIDHRFLVYDHVLGPDLTFSPLVFLQITQFKCGGLCIGLSWAHILGDVFSASTFMKTLGQLVSGHAPTKPVYPKTPELTSHARNDGEAISIEKIDSVGEYWLLTNKCKMGRHIFNFSLNHIDSLMAKYTTRDQPFSEVDILYALIWKSLLNIRGETNTNVITICDRKKSSTCWNEDLVISVVEKNDEMVGISELAALIAGEKREENGAIKRMIEQDKGSSDFFTYGANLTFVNLDEIDMYELEINGGKPDFVNYTIHGVGDKGVVLVFPKQNFARIVSVVMPEEDLAKLKEEVTNMII

Gene Information

Entrez Gene ID
828553
Gene Name
fatty acid elongation machinery component ECERIFERUM2
Gene Symbol
CER2
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:TAIR C endoplasmic reticulum
GO:0005634 IDA:TAIR C nucleus
GO:0016747 IEA:InterPro F transferase activity, transferring acyl groups other than amino-acyl groups
GO:0071555 IEA:UniProtKB-KW P cell wall organization
GO:0042761 IDA:TAIR P very long-chain fatty acid biosynthetic process
GO:0010025 IMP:TAIR P wax biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR023213 Chloramphenicol acetyltransferase-like domain
IPR003480 Transferase

UniProt Annotations

Entry Information

Gene Name
fatty acid elongation machinery component ECERIFERUM2
Protein Entry
CER2_ARATH
UniProt ID
Q39048
Species
Arabidopsis

Comments

Comment Type Description
Disruption Phenotype Bright green and glossy stems and siliques due to low abundance of cuticular wax. Increased levels of C26 and C28 alcohols and disappearance of C29 alkane and C30 alcohol in the stem wax. {ECO:0000269|PubMed:17376164, ECO:0000269|PubMed:8820603, ECO:0000269|PubMed:9390429}.
Function Involved in biosynthesis of the epicuticular wax. Plays a role in very-long-chain fatty acid (VLCFA) biosynthesis and is required for C28 fatty acid elongation in stem. Despite its classification as a BAHD acyltransferase based on sequence homology, CER2 does not seem to share the catalytic mechanism of the members of the BAHD family. {ECO:0000269|PubMed:17376164, ECO:0000269|PubMed:22930748, ECO:0000269|PubMed:23384041}.
Similarity Belongs to the plant acyltransferase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum. Nucleus {ECO:0000305}.
Tissue Specificity Expressed at high levels in the epidermis of stems and young siliques. Expressed in flowers. {ECO:0000269|PubMed:23384041, ECO:0000269|PubMed:8820603}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011090 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15233851 RefSeq NP_194182 421 fatty acid elongation machinery component ECERIFERUM2

Identical Sequences to LMP011090 proteins

Reference Database Accession Length Protein Name
GI:15233851 EMBL CAW82947.1 421 unnamed protein product [Arabidopsis thaliana]
GI:15233851 EMBL CBC84322.1 421 unnamed protein product [Arabidopsis thaliana]
GI:15233851 GenBank AAM64817.1 421 CER2 [Arabidopsis thaliana]
GI:15233851 GenBank ABH04588.1 421 At4g24510 [Arabidopsis thaliana]
GI:15233851 GenBank AEE84918.1 421 fatty acid elongation machinery component ECERIFERUM2 [Arabidopsis thaliana]
GI:15233851 SwissProt Q39048.1 421 RecName: Full=Protein ECERIFERUM 1 [Arabidopsis thaliana]

Related Sequences to LMP011090 proteins

Reference Database Accession Length Protein Name
GI:15233851 GenBank EFH45972.1 415 hypothetical protein ARALYDRAFT_492392 [Arabidopsis lyrata subsp. lyrata]
GI:15233851 GenBank EOA18936.1 417 hypothetical protein CARUB_v10007574mg [Capsella rubella]
GI:15233851 RefSeq XP_002869713.1 415 hypothetical protein ARALYDRAFT_492392 [Arabidopsis lyrata subsp. lyrata]
GI:15233851 RefSeq XP_006286038.1 417 hypothetical protein CARUB_v10007574mg [Capsella rubella]
GI:15233851 RefSeq XP_010433760.1 418 PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
GI:15233851 RefSeq XP_010448555.1 417 PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]