Gene/Proteome Database (LMPD)

LMPD ID
LMP011092
Gene ID
827018
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
HXXXD-type acyl-transferase-like protein
Gene Symbol
AT4G13840
Synonyms
F18A5.230; F18A5_230
Alternate Names
HXXXD-type acyl-transferase-like protein
Chromosome
4

Proteins

HXXXD-type acyl-transferase-like protein
Refseq ID NP_193120
Protein GI 15236357
UniProt ID Q9SVM9
mRNA ID NM_117458
Length 428
RefSeq Status REVIEWED
MGRSQEQGQGQGPVHSIRLSTVGATRPTETGTTHEPTGLDLAMKLHYLKAAYIYSAETARDLTVRHLKEAMFMLFDQIAWTTGRFSRRDSGRPYIKCNDCGTRFVEGQCNLTVEEWLSKPDRSVDEFLVYHHPIGPELTFSPLIYVQMTRFKCGGLGLGLSWANIIGDAFSLFYAFNLWAKAITGEKIYAPTTPSIGERRFQSPNPTVKDPVSIKRVEPVGDLWVTPNDKKLANYCFNLSVADQISPHFPAKGDDSIPVFEILAGIIWKCIAKVRVEPKPVTVTIIKKDPNDLKLNAIRNSQVISSVSVDFPVAEATVEELVKAMGEAKDERCGIEEIGESCDGNLDFVVYGAKLTFLDLTGEDLYEAKVMGKSPESVYCNVEGIGEEGLVVVYAAAKSEERVVTVTLPEEEMERVKLEFKKFGLIAP

Gene Information

Entrez Gene ID
827018
Gene Name
HXXXD-type acyl-transferase-like protein
Gene Symbol
AT4G13840
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:UniProtKB C cytosol
GO:0016747 IEA:InterPro F transferase activity, transferring acyl groups other than amino-acyl groups
GO:0071555 IEA:UniProtKB-KW P cell wall organization
GO:0042761 IMP:UniProtKB P very long-chain fatty acid biosynthetic process
GO:0010025 IMP:UniProtKB P wax biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR023213 Chloramphenicol acetyltransferase-like domain
IPR003480 Transferase

UniProt Annotations

Entry Information

Gene Name
HXXXD-type acyl-transferase-like protein
Protein Entry
CER26_ARATH
UniProt ID
Q9SVM9
Species
Arabidopsis

Comments

Comment Type Description
Disruption Phenotype No visible phenotype under normal growth conditions, but mutant plants have increased levels of C29 alkane and reduced levels of C31 alkane in the rosette leaf wax. {ECO:0000269|PubMed:22930748, ECO:0000269|PubMed:23384041}.
Function Involved in biosynthesis of the epicuticular wax. Plays a role in very-long-chain fatty acid (VLCFA) biosynthesis and is required for C30 fatty acid elongation in leaf. Despite its classification as a BAHD acyltransferase based on sequence homology, CER26 does not seem to share the catalytic mechanism of the members of the BAHD family. {ECO:0000269|PubMed:22930748, ECO:0000269|PubMed:23384041}.
Similarity Belongs to the plant acyltransferase family. {ECO:0000305}.
Subcellular Location Cytoplasm, cytosol {ECO:0000269|PubMed:23384041}.
Tissue Specificity Highly expressed in leaves. {ECO:0000269|PubMed:22930748, ECO:0000269|PubMed:23384041}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011092 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15236357 RefSeq NP_193120 428 HXXXD-type acyl-transferase-like protein

Identical Sequences to LMP011092 proteins

Reference Database Accession Length Protein Name
GI:15236357 DBBJ BAE98388.1 428 fatty acid elongase - like protein [Arabidopsis thaliana]
GI:15236357 EMBL CAW82945.1 428 unnamed protein product [Arabidopsis thaliana]
GI:15236357 EMBL CBC84318.1 428 unnamed protein product [Arabidopsis thaliana]
GI:15236357 GenBank AAN18163.1 428 At4g13840/F18A5_230 [Arabidopsis thaliana]
GI:15236357 GenBank AEE83332.1 428 HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
GI:15236357 SwissProt Q9SVM9.1 428 RecName: Full=Protein ECERIFERUM 26; AltName: Full=CER2-like protein 1; Short=CER2-like1 [Arabidopsis thaliana]

Related Sequences to LMP011092 proteins

Reference Database Accession Length Protein Name
GI:15236357 GenBank EFH44592.1 425 transferase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15236357 RefSeq XP_002868333.1 425 transferase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15236357 RefSeq XP_006283805.1 421 hypothetical protein CARUB_v10004904mg [Capsella rubella]
GI:15236357 RefSeq XP_010435220.1 428 PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
GI:15236357 RefSeq XP_010450155.1 428 PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
GI:15236357 RefSeq XP_010495840.1 428 PREDICTED: protein ECERIFERUM 26 [Camelina sativa]