Gene/Proteome Database (LMPD)
Proteins
| S-acyltransferase 10 | |
|---|---|
| Refseq ID | NP_566950 |
| Protein GI | 18409331 |
| UniProt ID | Q7XA86 |
| mRNA ID | NM_114998 |
| Length | 340 |
| RefSeq Status | REVIEWED |
| MGVCCPFLQPWDRARDQCLLNLPCLSDPVRRSSLLLKLALVALHLVFIGFLFLFDAEFIEKTKRDPWYMGCYILLFSATLLQYFVTSGSSPGYVVDAMRDVCEASAMYRNPSTTSIQHASRKSESVVVNVEGGSASCPRRPPTPWGKLVLDLYPPGTSIRNLTCGYCHVEQPPRTKHCHDCDRCVLQFDHHCVWLGTCIGQKNHSKFWWYICEETTLCIWTLIMYVDYLSNVAKPWWKNAIIILLLVILAISLIFVLLLLIFHSYLILTNQSTYELVRRRRIPYMRNIPGRVHPFSRGIRRNLYNVCCGNYNLDSLPTAFELEDRSRPYTCIDMLKCRCC | |
Gene Information
Entrez Gene ID
Gene Name
S-acyltransferase 10
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005774 | IDA:TAIR | C | vacuolar membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Developmental Stage | Expressd in tapetal layer of developing anthers and then expression gradually increases in developing microspores and in mature pollen. {ECO:0000269|PubMed:23482856}. |
| Disruption Phenotype | Pleiotropic growth defects, including smaller leaves, dwarfism, and sterility. Hypersensitivity to salt stress and compromised pollen tube growth. {ECO:0000269|PubMed:23482856}. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. {ECO:0000250}. |
| Function | S-acyltransferase involved in protein lipid modification. Catalyzes the palmitoylation of proteins peripheral or integral to the tonoplast. Required for the tonoplast localization of CBL2, CBL3 and CBL6, but not for the plasma membrane localization of CBL9, for the endosome localization of RABF1 or for the endomembrane localization of RABF2B. {ECO:0000269|PubMed:22968831, ECO:0000269|PubMed:23482856, ECO:0000269|Ref.5}. |
| Induction | Not regulated by salt stresses. {ECO:0000269|PubMed:23482856}. |
| Sequence Caution | Sequence=CAB63003.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the DHHC palmitoyltransferase family. {ECO:0000305}. |
| Similarity | Contains 1 DHHC-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00067}. |
| Subcellular Location | Vacuole membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. Note=Transient expression results in mistargeting of PAT10 to the Golgi apparatus, while the non- functional mutant is also localized in Golgi apparatus membranes. {ECO:0000269|PubMed:22968831, ECO:0000269|PubMed:23482856}. |
| Tissue Specificity | Expressed in mature embryos, embryo sacs, cotyledons, whole seedlings, hydathodes, guard cells, sites of lateral root initiation, root tips and phloem, but not in xylem. {ECO:0000269|PubMed:23482856}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011144 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18409331 | RefSeq | NP_566950 | 340 | S-acyltransferase 10 |
Identical Sequences to LMP011144 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18409331 | GenBank | AAQ22610.1 | 340 | At3g51390 [Arabidopsis thaliana] |
| GI:18409331 | GenBank | AEE78787.1 | 340 | S-acyltransferase 10 [Arabidopsis thaliana] |
| GI:18409331 | SwissProt | Q7XA86.1 | 340 | RecName: Full=Protein S-acyltransferase 10; AltName: Full=Probable palmitoyltransferase At3g51390; AltName: Full=Zinc finger DHHC domain-containing protein At3g51390 [Arabidopsis thaliana] |
Related Sequences to LMP011144 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18409331 | GenBank | AAM65117.1 | 340 | unknown [Arabidopsis thaliana] |
| GI:18409331 | GenBank | EFH52343.1 | 340 | zinc finger family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18409331 | RefSeq | XP_002876084.1 | 340 | zinc finger family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18409331 | RefSeq | XP_010503833.1 | 340 | PREDICTED: protein S-acyltransferase 10 isoform X1 [Camelina sativa] |
| GI:18409331 | RefSeq | XP_010515550.1 | 341 | PREDICTED: protein S-acyltransferase 10-like [Camelina sativa] |
| GI:18409331 | RefSeq | XP_010426696.1 | 340 | PREDICTED: protein S-acyltransferase 10-like [Camelina sativa] |