Gene/Proteome Database (LMPD)
Proteins
putative acyl-coenzyme A oxidase | |
---|---|
Refseq ID | NP_187325 |
Protein GI | 240255297 |
UniProt ID | P0CZ24 |
mRNA ID | NM_111549 |
Length | 187 |
RefSeq Status | REVIEWED |
MTKEPIYSPRMLHRDPDSPRPVLPTQLTSSTLRCSQFQTNVFCLRERDLLERFTSEVAQLQGRGESREFSFLLSHQLAEDLGKAFTEKAMLQTILDAEAKLPTGSVKDVLGLVRSMYALISLEEDPSLLRYGYLSQDNVGDVRREVSKLCGELRPHALALVTSFGIPDSFLSPIAFNWVEANTWSSV |
Gene Information
Entrez Gene ID
Gene Name
putative acyl-coenzyme A oxidase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005777 | IEA:InterPro | C | peroxisome |
GO:0003997 | IEA:UniProtKB-EC | F | acyl-CoA oxidase activity |
GO:0006635 | IEA:InterPro | P | fatty acid beta-oxidation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
putative acyl-coenzyme A oxidase
Protein Entry
Y3669_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acyl-CoA + O(2) = trans-2,3-dehydroacyl-CoA + H(2)O(2). |
Sequence Caution | Sequence=AAF63829.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=AAG50996.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
Similarity | Belongs to the acyl-CoA oxidase family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011172 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
240255297 | RefSeq | NP_187325 | 187 | putative acyl-coenzyme A oxidase |
Identical Sequences to LMP011172 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:240255297 | GenBank | AEE74442.1 | 187 | putative acyl-coenzyme A oxidase [Arabidopsis thaliana] |
GI:240255297 | SwissProt | P0CZ24.1 | 187 | RecName: Full=Putative acyl-coenzyme A oxidase At3g06690; Short=Acyl-CoA oxidase [Arabidopsis thaliana] |
Related Sequences to LMP011172 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:240255297 | EMBL | CBU85821.1 | 675 | unnamed protein product [Arabidopsis thaliana] |
GI:240255297 | EMBL | CBU90602.1 | 675 | unnamed protein product [Arabidopsis thaliana] |
GI:240255297 | EMBL | CBU96018.1 | 675 | unnamed protein product [Arabidopsis thaliana] |
GI:240255297 | GenBank | AAF73843.1 | 675 | acyl-CoA oxidase ACX3 [Arabidopsis thaliana] |
GI:240255297 | GenBank | AAF76137.1 | 675 | acyl-CoA oxidase [Arabidopsis thaliana] |
GI:240255297 | GenBank | AEE27972.1 | 675 | acyl-coenzyme A oxidase 3 [Arabidopsis thaliana] |