Gene/Proteome Database (LMPD)
Proteins
putative clathrin assembly protein | |
---|---|
Refseq ID | NP_564922 |
Protein GI | 18408946 |
UniProt ID | Q9C9X5 |
mRNA ID | NM_105481 |
Length | 379 |
RefSeq Status | REVIEWED |
MKLWKRAAAAIKDRKSLLAVGFSRRNSSYRNADLEAAIIKATSHDDSSVDYSNAHRVYKWIRSSPLNLKTLVYAISSRVNHTRSWIVALKSLMLLHGVLCCKVPSVVGEFRRLPFDLSDFSDGHSCLSKTWGFNVFVRTYFAFLHHYSSFLSDQIHRLRGNNRRSLEKTSDSVIQELERIQKLQSLLDMILQIRPVADNMKKTLILEAMDCLVIESINIYGRICGAVMKVLPLAGKSEAATVLKIVNKTTSQGEDLIVYFEFCKGFGVSNAREIPQFVRIPEEEVEAIEKMIDTVQEKPKLEKDEEKEDEKAMVVLEQPKKLQTIITDKWEIFEDDYRCFDRKDKWEIFEDEYHQNHLPLITMNQPVYITYTMPDLITF |
Gene Information
Entrez Gene ID
Gene Name
putative clathrin assembly protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0030118 | IEA:InterPro | C | clathrin coat |
GO:0005905 | IEA:UniProtKB-KW | C | coated pit |
GO:0031410 | IEA:UniProtKB-KW | C | cytoplasmic vesicle |
GO:0005545 | IEA:InterPro | F | 1-phosphatidylinositol binding |
GO:0048268 | IEA:InterPro | P | clathrin coat assembly |
GO:0006897 | IEA:UniProtKB-KW | P | endocytosis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
putative clathrin assembly protein
Protein Entry
CAP12_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Similarity | Contains 1 ENTH (epsin N-terminal homology) domain. {ECO:0000255|PROSITE-ProRule:PRU00243}. |
Subcellular Location | Membrane, clathrin-coated pit {ECO:0000250}. Golgi apparatus {ECO:0000250}. Cytoplasmic vesicle, clathrin- coated vesicle {ECO:0000250}. Note=Colocalized with clathrin in the Golgi area. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011180 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
18408946 | RefSeq | NP_564922 | 379 | putative clathrin assembly protein |
Identical Sequences to LMP011180 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18408946 | GenBank | AAG52005.1 | 379 | hypothetical protein; 19489-18350 [Arabidopsis thaliana] |
GI:18408946 | GenBank | AAK95264.1 | 379 | At1g68110/T23K23_4 [Arabidopsis thaliana] |
GI:18408946 | GenBank | AAN31077.1 | 379 | At1g68110/T23K23_4 [Arabidopsis thaliana] |
GI:18408946 | GenBank | AEE34750.1 | 379 | putative clathrin assembly protein [Arabidopsis thaliana] |
GI:18408946 | SwissProt | Q9C9X5.1 | 379 | RecName: Full=Putative clathrin assembly protein At1g68110 [Arabidopsis thaliana] |
Related Sequences to LMP011180 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18408946 | GenBank | EFH64897.1 | 373 | hypothetical protein ARALYDRAFT_894560 [Arabidopsis lyrata subsp. lyrata] |
GI:18408946 | GenBank | EOA34223.1 | 373 | hypothetical protein CARUB_v10021734mg [Capsella rubella] |
GI:18408946 | RefSeq | XP_002888638.1 | 373 | hypothetical protein ARALYDRAFT_894560 [Arabidopsis lyrata subsp. lyrata] |
GI:18408946 | RefSeq | XP_006301325.1 | 373 | hypothetical protein CARUB_v10021734mg [Capsella rubella] |
GI:18408946 | RefSeq | XP_010511773.1 | 365 | PREDICTED: putative clathrin assembly protein At1g68110 [Camelina sativa] |
GI:18408946 | RefSeq | XP_010470740.1 | 372 | PREDICTED: putative clathrin assembly protein At1g68110 [Camelina sativa] |