Gene/Proteome Database (LMPD)

LMPD ID
LMP011206
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
putative lipid-transfer protein DIR1
Gene Symbol
Synonyms
DEFECTIVE IN INDUCED RESISTANCE 1; DIR1
Alternate Names
putative lipid-transfer protein DIR1
Chromosome
5

Proteins

putative lipid-transfer protein DIR1
Refseq ID NP_568699
Protein GI 18422920
UniProt ID Q8W453
mRNA ID NM_124224
Length 102
RefSeq Status REVIEWED
MASKKAAMVMMAMIVIMAMLVDTSVAIDLCGMSQDELNECKPAVSKENPTSPSQPCCTALQHADFACLCGYKNSPWLGSFGVDPELASALPKQCGLANAPTC

Gene Information

Entrez Gene ID
Gene Name
putative lipid-transfer protein DIR1
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0048046 IEA:UniProtKB-KW C apoplast
GO:0005783 IDA:UniProtKB C endoplasmic reticulum
GO:0009506 IDA:UniProtKB C plasmodesma
GO:0005504 IDA:UniProtKB F fatty acid binding
GO:0043621 IDA:UniProtKB F protein self-association
GO:0008270 IDA:UniProtKB F zinc ion binding
GO:0006869 IEA:UniProtKB-KW P lipid transport
GO:0009862 IMP:UniProtKB P systemic acquired resistance, salicylic acid mediated signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain

UniProt Annotations

Entry Information

Gene Name
putative lipid-transfer protein DIR1
Protein Entry
DIRL1_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Cofactor Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Note=Binds 1 zinc ion per subunit.;
Disruption Phenotype No visible phenotype under normal growth condition, but compromised pathogen-induced glycerol-3-phosphate- (G3P) and azelaic acid- (AA) dependent systemic acquired resistance (SAR). {ECO:0000269|PubMed:12353036, ECO:0000269|PubMed:23602565}.
Function Putative lipid transfer protein required for systemic acquired resistance (SAR) long distance signaling. May interact with a lipid-derived molecule to promote long distance signaling associated with SAR. Together with AZI1, required for glycerol-3- phosphate- (G3P) and azelaic acid- (AA) induced systemic acquired resistance (SAR). Component of plant systemic immunity involved in priming defenses in a AA-dependent manner, by modulating production and/or translocation of a mobile signal(s) during SAR. {ECO:0000269|PubMed:12353036, ECO:0000269|PubMed:23602565}.
Induction Induced by glycerol-3-phosphate (G3P). {ECO:0000269|PubMed:23602565}.
Similarity Belongs to the A9/FIL1 family. {ECO:0000305}.
Subcellular Location Secreted, extracellular space, apoplast {ECO:0000305}. Endoplasmic reticulum {ECO:0000269|PubMed:23602565}. Cell junction, plasmodesma {ECO:0000269|PubMed:23602565}.
Subunit Self-interacts and binds to AZI1. {ECO:0000269|PubMed:18552128, ECO:0000269|PubMed:23602565}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011206 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18422920 RefSeq NP_568699 102 putative lipid-transfer protein DIR1

Identical Sequences to LMP011206 proteins

Reference Database Accession Length Protein Name
GI:18422920 GenBank AAL32935.1 102 Unknown protein [Arabidopsis thaliana]
GI:18422920 GenBank AAL76110.1 102 DIR1 protein [Arabidopsis thaliana]
GI:18422920 GenBank AAP21318.1 102 At5g48485 [Arabidopsis thaliana]
GI:18422920 gnl TAIR 102 putative lipid-transfer protein DIR1 [Arabidopsis thaliana]
GI:18422920 SwissProt Q8W453.1 102 RecName: Full=Putative lipid-transfer protein DIR1; AltName: Full=Protein DEFECTIVE IN INDUCED RESISTANCE 1; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP011206 proteins

Reference Database Accession Length Protein Name
GI:18422920 GenBank AAM62457.1 102 unknown [Arabidopsis thaliana]
GI:18422920 GenBank EFH41898.1 103 hypothetical protein ARALYDRAFT_917749 [Arabidopsis lyrata subsp. lyrata]
GI:18422920 GenBank EOA14270.1 102 hypothetical protein CARUB_v10027430mg [Capsella rubella]
GI:18422920 RefSeq XP_002865639.1 103 hypothetical protein ARALYDRAFT_917749 [Arabidopsis lyrata subsp. lyrata]
GI:18422920 RefSeq XP_006281372.1 102 hypothetical protein CARUB_v10027430mg [Capsella rubella]
GI:18422920 RefSeq XP_010482097.1 103 PREDICTED: putative lipid-transfer protein DIR1 [Camelina sativa]