Gene/Proteome Database (LMPD)

LMPD ID
LMP011287
Gene ID
824012
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
SNF1-related protein kinase regulatory subunit gamma 1
Gene Symbol
KING1
Synonyms
SNF1-related protein kinase regulatory subunit gamma 1
Alternate Names
SNF1-related protein kinase regulatory subunit gamma 1
Chromosome
3

Proteins

SNF1-related protein kinase regulatory subunit gamma 1
Refseq ID NP_190422
Protein GI 15228397
UniProt ID Q8LBB2
mRNA ID NM_114711
Length 424
RefSeq Status REVIEWED
MATVPEIKIMRSESLGHRSDVSSPEAKLGMRVEDLWDEQKPQLSPNEKLNACFESIPVSAFPLSSDSQDIEIRSDTSLAEAVQTLSKFKVLSAPVVDVDAPEDASWIDRYIGIVEFPGIVVWLLHQLEPPSPRSPAVAASNGFSHDFTTDVLDNGDSAVTSGNFFEVLTSSELYKNTKVRDISGTFRWAPFLALQKENSFLTMLLLLSKYKMKSIPVVDLGVAKIENIITQSGVIHMLAECAGLLWFEDWGIKTLSEVGLPIMSKDHIIKIYEDEPVLQAFKLMRRKRIGGIPVIERNSEKPVGNISLRDVQFLLTAPEIYHDYRSITTKNFLVSVREHLEKCGDTSAPIMSGVIACTKNHTLKELILMLDAEKIHRIYVVDDFGNLEGLITLRDIIARLVHEPSGYFGDFFDGVMPLPENYRV

Gene Information

Entrez Gene ID
824012
Gene Name
SNF1-related protein kinase regulatory subunit gamma 1
Gene Symbol
KING1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009505 IDA:TAIR C plant-type cell wall
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0003824 IEA:InterPro F catalytic activity
GO:0005975 IEA:UniProtKB-KW P carbohydrate metabolic process
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process
GO:0042128 IEA:UniProtKB-KW P nitrate assimilation

Domain Information

InterPro Annotations

Accession Description
IPR013785 Aldolase-type TIM barrel
IPR000644 CBS domain

UniProt Annotations

Entry Information

Gene Name
SNF1-related protein kinase regulatory subunit gamma 1
Protein Entry
KING1_ARATH
UniProt ID
Q8LBB2
Species
Arabidopsis

Comments

Comment Type Description
Function Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants. The SnRK complex may also be involved in the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase and in assimilation of nitrogen by phosphorylating nitrate reductase.
Induction Strongly induced in the dark. {ECO:0000269|PubMed:10417704}.
Similarity Belongs to the 5'-AMP-activated protein kinase gamma subunit family. {ECO:0000305}.
Similarity Contains 4 CBS domains. {ECO:0000255|PROSITE- ProRule:PRU00703}.
Subunit Subunit of a probable heterotrimeric complex consisting of an alpha catalytic (KIN10 or KIN11) subunit, and a beta (KINB) and a gamma (KING or SNF4) non-catalytic regulatory subunits.
Tissue Specificity Expressed in vegetative organs and, to lower extent, in reproductive organs. {ECO:0000269|PubMed:10417704}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011287 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15228397 RefSeq NP_190422 424 SNF1-related protein kinase regulatory subunit gamma 1

Identical Sequences to LMP011287 proteins

Reference Database Accession Length Protein Name
GI:15228397 GenBank AAK68779.1 424 putative protein [Arabidopsis thaliana]
GI:15228397 GenBank AAM10026.1 424 putative protein [Arabidopsis thaliana]
GI:15228397 GenBank ACX17248.1 424 Sequence 44659 from patent US 7569389
GI:15228397 GenBank ADT59792.1 424 Sequence 474 from patent US 7847156
GI:15228397 GenBank AEE78427.1 424 SNF1-related protein kinase regulatory subunit gamma 1 [Arabidopsis thaliana]
GI:15228397 SwissProt Q8LBB2.2 424 RecName: Full=SNF1-related protein kinase regulatory subunit gamma-1; Short=AKIN subunit gamma-1; Short=AKING1; Short=AKINgamma1; AltName: Full=CBS domain-containing protein CBSCBS1 [Arabidopsis thaliana]

Related Sequences to LMP011287 proteins

Reference Database Accession Length Protein Name
GI:15228397 GenBank AAM64867.1 424 unknown [Arabidopsis thaliana]
GI:15228397 GenBank ACX04426.1 424 Sequence 27245 from patent US 7569389
GI:15228397 GenBank ACX16065.1 424 Sequence 43055 from patent US 7569389
GI:15228397 GenBank EFH52170.1 424 CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
GI:15228397 GenBank AEL85478.1 424 Sequence 1338 from patent US 7989676
GI:15228397 RefSeq XP_002875911.1 424 CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]