Gene/Proteome Database (LMPD)
LMPD ID
LMP011299
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
sphingoid base hydroxylase 2
Gene Symbol
Synonyms
F14L17.5; F14L17_5; SBH2; sphingoid base hydroxylase 2
Alternate Names
sphingoid base hydroxylase 2
Chromosome
1
EC Number
1.14.13.169
Summary
Encodes one of the two redundant sphingoid base hydroxylases (SBH). Involved in sphingolipid trihydroxy long-chain base (4-hydroxysphinganine) biosynthesis. Double mutants of SBHs were dwarfed and not able to progress from vegetative to reproductive growth.
Orthologs
Proteins
| sphingoid base hydroxylase 2 | |
|---|---|
| Refseq ID | NP_563944 |
| Protein GI | 18394095 |
| UniProt ID | Q9AST3 |
| mRNA ID | NM_101295 |
| Length | 259 |
| RefSeq Status | REVIEWED |
| MMSFVISDEFLGTFVPILVYWVYSGMYICLGSLDKYRLHSKIDEDEKNLVSKSAVVKGVLLQQTLQAIISVILFKITGSDADAATTQQFSILLLARQFIIAMLVIDTWQYFIHRYMHLNKFLYKHIHSQHHRLIVPYSYGALYNHPLEGLLLDTIGGALSFLFSGMSPRTAIFFFSFATIKTVDDHCGLWLPGNPFHIFFSNNSAYHDVHHQLYGTKYNFSQPFFVMWDRILGTYLPYSLEKRANGGFETRPIKVSKDE | |
Gene Information
Entrez Gene ID
Gene Name
sphingoid base hydroxylase 2
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IDA:TAIR | C | Golgi apparatus |
| GO:0005783 | IDA:TAIR | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0000170 | IGI:TAIR | F | sphingosine hydroxylase activity |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
| GO:0009640 | IMP:TAIR | P | photomorphogenesis |
| GO:0046520 | IMP:TAIR | P | sphingoid biosynthetic process |
KEGG Pathway Links
BIOCYC Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Gene Name
sphingoid base hydroxylase 2
Protein Entry
SBH2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Sphinganine + NADPH + O(2) = phytosphingosine + NADP(+) + H(2)O. {ECO:0000269|PubMed:11297741}. |
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Disruption Phenotype | No visible phenotype; due to the redundancy with SBH1. Sbh1 and sbh2 double mutants are severely dwarfed, do not progress from vegetative to reproductive growth and have enhanced expression of programmed cell death associated-genes. {ECO:0000269|PubMed:18612100}. |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
| Function | Involved in sphingolipid trihydroxy long-chain base (4- hydroxysphinganine) biosynthesis. Can use C18- and C20-sphinganine as substrates to produce C18- and C20-phytosphinganines (D-ribo-2- amino-1,3,4-trihydroxyoctadecane and -eicosane). {ECO:0000269|PubMed:11297741, ECO:0000269|PubMed:18612100}. |
| Pathway | Membrane lipid metabolism; sphingolipid biosynthesis. |
| Sequence Caution | Sequence=AAF43928.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; |
| Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:18612100}; Multi-pass membrane protein {ECO:0000269|PubMed:18612100}. |
| Tissue Specificity | Ubiquitous, with higher levels in flowers and roots. {ECO:0000269|PubMed:18612100}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011299 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18394095 | RefSeq | NP_563944 | 259 | sphingoid base hydroxylase 2 |
Identical Sequences to LMP011299 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18394095 | GenBank | AAK32868.1 | 259 | At1g14290/F14L17_4 [Arabidopsis thaliana] |
| GI:18394095 | GenBank | AAN64519.1 | 259 | At1g14290/F14L17_4 [Arabidopsis thaliana] |
| GI:18394095 | GenBank | AEE29139.1 | 259 | sphingoid base hydroxylase 2 [Arabidopsis thaliana] |
| GI:18394095 | SwissProt | Q9AST3.1 | 259 | RecName: Full=Sphinganine C(4)-monooxygenase 2; AltName: Full=Sphingoid C4-hydroxylase 2; AltName: Full=Sphingoid base hydroxylase 2 [Arabidopsis thaliana] |
Related Sequences to LMP011299 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18394095 | GenBank | AAF43928.1 | 258 | Contains similarity to acid phosphatase from Lupinus albus gb|AB023385 and contains a Sterol desaturase PF|01598 domain. EST gb|AI995340 comes from this gene [Arabidopsis thaliana] |
| GI:18394095 | GenBank | EFH69057.1 | 259 | hypothetical protein ARALYDRAFT_888804 [Arabidopsis lyrata subsp. lyrata] |
| GI:18394095 | GenBank | KFK43671.1 | 259 | hypothetical protein AALP_AA1G158000 [Arabis alpina] |
| GI:18394095 | RefSeq | XP_002892798.1 | 259 | hypothetical protein ARALYDRAFT_888804 [Arabidopsis lyrata subsp. lyrata] |
| GI:18394095 | RefSeq | XP_010458922.1 | 259 | PREDICTED: sphinganine C(4)-monooxygenase 2-like [Camelina sativa] |
| GI:18394095 | RefSeq | XP_010476478.1 | 259 | PREDICTED: sphinganine C(4)-monooxygenase 2-like [Camelina sativa] |