Gene/Proteome Database (LMPD)

LMPD ID
LMP011299
Gene ID
837990
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
sphingoid base hydroxylase 2
Gene Symbol
SBH2
Synonyms
F14L17.5; F14L17_5; SBH2; sphingoid base hydroxylase 2
Alternate Names
sphingoid base hydroxylase 2
Chromosome
1
EC Number
1.14.13.169
Summary
Encodes one of the two redundant sphingoid base hydroxylases (SBH). Involved in sphingolipid trihydroxy long-chain base (4-hydroxysphinganine) biosynthesis. Double mutants of SBHs were dwarfed and not able to progress from vegetative to reproductive growth.
Orthologs
View orthologs and multiple alignments for SBH2

Proteins

sphingoid base hydroxylase 2
Refseq ID NP_563944
Protein GI 18394095
UniProt ID Q9AST3
mRNA ID NM_101295
Length 259
RefSeq Status REVIEWED
MMSFVISDEFLGTFVPILVYWVYSGMYICLGSLDKYRLHSKIDEDEKNLVSKSAVVKGVLLQQTLQAIISVILFKITGSDADAATTQQFSILLLARQFIIAMLVIDTWQYFIHRYMHLNKFLYKHIHSQHHRLIVPYSYGALYNHPLEGLLLDTIGGALSFLFSGMSPRTAIFFFSFATIKTVDDHCGLWLPGNPFHIFFSNNSAYHDVHHQLYGTKYNFSQPFFVMWDRILGTYLPYSLEKRANGGFETRPIKVSKDE

Gene Information

Entrez Gene ID
837990
Gene Name
sphingoid base hydroxylase 2
Gene Symbol
SBH2
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:TAIR C endoplasmic reticulum
GO:0005794 IDA:TAIR C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005506 IEA:InterPro F iron ion binding
GO:0000170 IGI:TAIR F sphingosine hydroxylase activity
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0009640 IMP:TAIR P photomorphogenesis
GO:0046520 IMP:TAIR P sphingoid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01100 Metabolic pathways
ath00600 Sphingolipid metabolism

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5129 sphingolipid biosynthesis (plants)
PWY-5129 sphingolipid biosynthesis (plants)

Domain Information

InterPro Annotations

Accession Description
IPR006694 Fatty_acid_hydroxylase

UniProt Annotations

Entry Information

Gene Name
sphingoid base hydroxylase 2
Protein Entry
SBH2_ARATH
UniProt ID
Q9AST3
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Sphinganine + NADPH + O(2) = phytosphingosine + NADP(+) + H(2)O. {ECO:0000269|PubMed:11297741}.
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250};
Disruption Phenotype No visible phenotype; due to the redundancy with SBH1. Sbh1 and sbh2 double mutants are severely dwarfed, do not progress from vegetative to reproductive growth and have enhanced expression of programmed cell death associated-genes. {ECO:0000269|PubMed:18612100}.
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding.
Function Involved in sphingolipid trihydroxy long-chain base (4- hydroxysphinganine) biosynthesis. Can use C18- and C20-sphinganine as substrates to produce C18- and C20-phytosphinganines (D-ribo-2- amino-1,3,4-trihydroxyoctadecane and -eicosane). {ECO:0000269|PubMed:11297741, ECO:0000269|PubMed:18612100}.
Pathway Membrane lipid metabolism; sphingolipid biosynthesis.
Sequence Caution Sequence=AAF43928.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Similarity Belongs to the sterol desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000269|PubMed:18612100}; Multi-pass membrane protein {ECO:0000269|PubMed:18612100}.
Tissue Specificity Ubiquitous, with higher levels in flowers and roots. {ECO:0000269|PubMed:18612100}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011299 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18394095 RefSeq NP_563944 259 sphingoid base hydroxylase 2

Identical Sequences to LMP011299 proteins

Reference Database Accession Length Protein Name
GI:18394095 GenBank AAK32868.1 259 At1g14290/F14L17_4 [Arabidopsis thaliana]
GI:18394095 GenBank AAN64519.1 259 At1g14290/F14L17_4 [Arabidopsis thaliana]
GI:18394095 GenBank AEE29139.1 259 sphingoid base hydroxylase 2 [Arabidopsis thaliana]
GI:18394095 SwissProt Q9AST3.1 259 RecName: Full=Sphinganine C(4)-monooxygenase 2; AltName: Full=Sphingoid C4-hydroxylase 2; AltName: Full=Sphingoid base hydroxylase 2 [Arabidopsis thaliana]

Related Sequences to LMP011299 proteins

Reference Database Accession Length Protein Name
GI:18394095 GenBank AAF43928.1 258 Contains similarity to acid phosphatase from Lupinus albus gb|AB023385 and contains a Sterol desaturase PF|01598 domain. EST gb|AI995340 comes from this gene [Arabidopsis thaliana]
GI:18394095 GenBank EFH69057.1 259 hypothetical protein ARALYDRAFT_888804 [Arabidopsis lyrata subsp. lyrata]
GI:18394095 GenBank KFK43671.1 259 hypothetical protein AALP_AA1G158000 [Arabis alpina]
GI:18394095 RefSeq XP_002892798.1 259 hypothetical protein ARALYDRAFT_888804 [Arabidopsis lyrata subsp. lyrata]
GI:18394095 RefSeq XP_010458922.1 259 PREDICTED: sphinganine C(4)-monooxygenase 2-like [Camelina sativa]
GI:18394095 RefSeq XP_010476478.1 259 PREDICTED: sphinganine C(4)-monooxygenase 2-like [Camelina sativa]