Gene/Proteome Database (LMPD)

LMPD ID
LMP011313
Gene ID
839275
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
squamosa promoter binding protein-like 8
Gene Symbol
SPL8
Synonyms
squamosa promoter binding protein-like 8
Chromosome
1
Summary
Encodes an SBP-box gene, a member of the SPL gene family. Mutants are affected in micro- and megasporogenesis, trichome formation on sepals, and stamen filament elongation.
Orthologs
View orthologs and multiple alignments for SPL8

Proteins

squamosa promoter binding protein-like 8
Refseq ID NP_683267
Protein GI 22329284
UniProt ID Q8GXL3
mRNA ID NM_148426
Length 333
RefSeq Status REVIEWED
MLDYEWDNPSSIVLSGDERNPDSDPTRSSFSFFDPISHYNNDHRHITISPPLLSSFSNNHHLTLYGQTNSNNQFLHHHHHHHSLYGSTTTTTPYGASDPIYHPHSSAPPASLFSYDQTGPGSGSGSSYNFLIPKTEVDFTSNRIGLNLGGRTYFSAADDDFVSRLYRRSRPGESGMANSLSTPRCQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKCHQSASATQDTGTGKTTPKSPNDSGVKASSSPSSNAPPTISLECFRQRQFQTTASSSTSASSSSNSMFFSSG
squamosa promoter binding protein-like 8
Refseq ID NP_973738
Protein GI 42571295
UniProt ID Q3EDL2
mRNA ID NM_202009
Length 246
RefSeq Status REVIEWED
MLDYEWDNPSSIVLSGDERNPDSDPTRSSFSFFDPISHYNNDHRHITISPPLLSSFSNNHHLTLYGQTNSNNQFLHHHHHHHSLYGSTTTTTPYGASDPIYHPHSSAPPASLFSYDQTGPGSGSGSSYNFLIPKTEVDFTSNRIGLNLGGRTYFSAADDDFVSRLYRRSRPGESGMANSLSTPRCQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFVPPKVATFDLF

Gene Information

Entrez Gene ID
839275
Gene Name
squamosa promoter binding protein-like 8
Gene Symbol
SPL8
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005634 IEA:InterPro C nucleus
GO:0003677 IEA:InterPro F DNA binding

Domain Information

InterPro Annotations

Accession Description
IPR004333 Transcpt_factor_SBP-box

UniProt Annotations

Entry Information

Gene Name
squamosa promoter binding protein-like 8
Protein Entry
SPL8_ARATH
UniProt ID
Q8GXL3
Species
Arabidopsis

Identical and Related Proteins

Unique RefSeq proteins for LMP011313 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22329284 RefSeq NP_683267 333 squamosa promoter binding protein-like 8
42571295 RefSeq NP_973738 246 squamosa promoter binding protein-like 8

Identical Sequences to LMP011313 proteins

Reference Database Accession Length Protein Name
GI:22329284 GenBank ABP32575.1 333 Sequence 104 from patent US 7196245
GI:22329284 GenBank ADS94031.1 333 Sequence 104 from patent US 7825296
GI:42571295 GenBank AEE27373.1 246 squamosa promoter-binding-like protein 8 [Arabidopsis thaliana]
GI:22329284 GenBank AEE27374.1 333 squamosa promoter-binding-like protein 8 [Arabidopsis thaliana]
GI:22329284 GenBank AEQ40155.1 333 Sequence 388 from patent US 8030546
GI:22329284 GenBank AGX49122.1 333 Sequence 104 from patent US 8541665
GI:22329284 SwissProt Q8GXL3.2 333 RecName: Full=Squamosa promoter-binding-like protein 8 [Arabidopsis thaliana]

Related Sequences to LMP011313 proteins

Reference Database Accession Length Protein Name
GI:22329284 DBBJ BAC42797.1 333 putative squamosa promoter binding protein 8 SPL8 [Arabidopsis thaliana]
GI:42571295 EMBL CAB56593.1 333 squamosa promoter binding protein-like 8 [Arabidopsis thaliana]
GI:42571295 EMBL CAB56594.1 333 squamosa promoter binding protein-like 8 [Arabidopsis thaliana]
GI:42571295 GenBank ABP32575.1 333 Sequence 104 from patent US 7196245
GI:22329284 GenBank EFH68290.1 323 hypothetical protein ARALYDRAFT_470069 [Arabidopsis lyrata subsp. lyrata]
GI:42571295 GenBank ADS94031.1 333 Sequence 104 from patent US 7825296
GI:22329284 GenBank AEE27373.1 246 squamosa promoter-binding-like protein 8 [Arabidopsis thaliana]
GI:42571295 GenBank AEE27374.1 333 squamosa promoter-binding-like protein 8 [Arabidopsis thaliana]
GI:42571295 RefSeq NP_683267.1 333 squamosa promoter binding protein-like 8 [Arabidopsis thaliana]
GI:22329284 RefSeq NP_973738.1 246 squamosa promoter binding protein-like 8 [Arabidopsis thaliana]
GI:22329284 RefSeq XP_002892031.1 323 hypothetical protein ARALYDRAFT_470069 [Arabidopsis lyrata subsp. lyrata]
GI:22329284 RefSeq XP_010479450.1 334 PREDICTED: squamosa promoter-binding-like protein 8 [Camelina sativa]