Gene/Proteome Database (LMPD)

LMPD ID
LMP011353
Gene ID
829729
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
thiol-disulfide oxidoreductase LTO1
Gene Symbol
AT4G35760
Synonyms
F4B14.2
Alternate Names
thiol-disulfide oxidoreductase LTO1
Chromosome
4
EC Number
1.1.4.-
Summary
Encodes a bimodular enzyme comprising an integral domain homologous to the catalytic subunit of mammalian vitamin K epoxide reductase (VKORC1, EC 1.1.4.1) that is fused to a soluble thioredoxin-like moiety. Using yeast microsomes as a recombinant system, it was shown that the VKORC1 domain of At4g35760 functions as a stringent naphthoquinone reductase, and that its reduced Trx-like partner can serve as its electron donor. Located in plastid.
Orthologs
View orthologs and multiple alignments for AT4G35760

Proteins

thiol-disulfide oxidoreductase LTO1
Refseq ID NP_567988
Protein GI 18419647
UniProt ID Q8L540
mRNA ID NM_119742
Length 376
RefSeq Status REVIEWED
MMARFVSVSSCQFHFGFREVSPPSVTSYPRRFEVSDRRFPAIPIKCSSSEPENGEDSAPSLSSSSSSSTSEVSTSNSSTYNWYTGIGGIGMLDTAYLTYLKVTGSDAFCPIGGGTCGDVLNSDYAVVFGVPLPVIGFVMYGVVTALSAELGEGNLPFGISKSNGRFALFGITTAMASASAYFLYILSTKLSGSSCLYCLVSAFLSFSLFFLSVKDVKLQEIQQVVGLQICLAIIVVASLTASYSTAQPIPSRSGDIELPYFRTEISSSSSPYAIALAKHLNSIGAKMYGAFWCSHCLEQKEMFGREAAKELNYVECFPDGYKKGTKILKACADAAIEGFPTWIINDKVLSGEIELAELAEMTGFSLDQANETNQLQ

Gene Information

Entrez Gene ID
829729
Gene Name
thiol-disulfide oxidoreductase LTO1
Gene Symbol
AT4G35760
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IDA:TAIR C chloroplast
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0009536 IDA:TAIR C plastid
GO:0009579 IEA:UniProtKB-KW C thylakoid
GO:0003955 IDA:TAIR F NAD(P)H dehydrogenase (quinone) activity
GO:0048038 IEA:UniProtKB-KW F quinone binding
GO:0010207 IMP:TAIR P photosystem II assembly

Domain Information

InterPro Annotations

Accession Description
IPR012336 Thioredoxin-like fold
IPR012932 Vitamin K epoxide reductase

UniProt Annotations

Entry Information

Gene Name
thiol-disulfide oxidoreductase LTO1
Protein Entry
LTO1_ARATH
UniProt ID
Q8L540
Species
Arabidopsis

Comments

Comment Type Description
Disruption Phenotype Severe growth defects due to a limitation in the electron flow from PSII. {ECO:0000269|PubMed:22209765, ECO:0000269|PubMed:23689258}.
Function Thiol-disulfide oxidoreductase catalyzing disulfide bond formation of chloroplast proteins and involved in redox regulation and photosynthetic electron transport. Required for the assembly of photosystem II (PSII) through the formation of disulfide bond in PSBO, a subunit of the PSII oxygen-evolving complex in the thylakoid lumen. Involved in the formation of disulfide bonds in the lumenal protein FKBP13. In vitro, reduces phylloquinone (vitamin K1) and menaquinone (vitamin K2) to their respective quinol. Cannot reduce phylloquinone epoxide to phylloquinone. {ECO:0000269|PubMed:20626653, ECO:0000269|PubMed:21781282, ECO:0000269|PubMed:22209765, ECO:0000269|PubMed:23689258}.
Sequence Caution Sequence=AAM65737.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=CAA20046.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAB81485.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the VKOR family. {ECO:0000305}.
Subcellular Location Plastid, chloroplast thylakoid membrane {ECO:0000305|PubMed:20626653, ECO:0000305|PubMed:21781282}; Multi- pass membrane protein {ECO:0000305|PubMed:20626653, ECO:0000305|PubMed:21781282}.
Subunit Interacts with the PSII subunits PSBO1 and PSBO2. {ECO:0000269|PubMed:22209765}.
Tissue Specificity Expressed in cotyledons, rosette leaves, stems, cauline leaves and flowers. {ECO:0000269|PubMed:20626653}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011353 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18419647 RefSeq NP_567988 376 thiol-disulfide oxidoreductase LTO1

Identical Sequences to LMP011353 proteins

Reference Database Accession Length Protein Name
GI:18419647 GenBank AAM20579.1 376 putative protein [Arabidopsis thaliana]
GI:18419647 GenBank AAM91303.1 376 putative protein [Arabidopsis thaliana]
GI:18419647 GenBank AEE86559.1 376 NAD(P)H dehydrogenase (quinone)s [Arabidopsis thaliana]
GI:18419647 SwissProt Q8L540.1 376 RecName: Full=Thiol-disulfide oxidoreductase LTO1; AltName: Full=Protein LUMEN THIOL OXIDOREDUCTASE 1; AltName: Full=Vitamin K reductase; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP011353 proteins

Reference Database Accession Length Protein Name
GI:18419647 GenBank AAM65737.1 375 unknown [Arabidopsis thaliana]
GI:18419647 GenBank EFH43316.1 375 hypothetical protein ARALYDRAFT_491070 [Arabidopsis lyrata subsp. lyrata]
GI:18419647 RefSeq XP_002867057.1 375 hypothetical protein ARALYDRAFT_491070 [Arabidopsis lyrata subsp. lyrata]
GI:18419647 RefSeq XP_006283933.1 378 hypothetical protein CARUB_v10005052mg [Capsella rubella]
GI:18419647 RefSeq XP_010432235.1 374 PREDICTED: thiol-disulfide oxidoreductase LTO1-like [Camelina sativa]
GI:18419647 RefSeq XP_010446882.1 374 PREDICTED: thiol-disulfide oxidoreductase LTO1 [Camelina sativa]