Gene/Proteome Database (LMPD)
LMPD ID
LMP011353
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
thiol-disulfide oxidoreductase LTO1
Gene Symbol
Synonyms
F4B14.2
Alternate Names
thiol-disulfide oxidoreductase LTO1
Chromosome
4
EC Number
1.1.4.-
Summary
Encodes a bimodular enzyme comprising an integral domain homologous to the catalytic subunit of mammalian vitamin K epoxide reductase (VKORC1, EC 1.1.4.1) that is fused to a soluble thioredoxin-like moiety. Using yeast microsomes as a recombinant system, it was shown that the VKORC1 domain of At4g35760 functions as a stringent naphthoquinone reductase, and that its reduced Trx-like partner can serve as its electron donor. Located in plastid.
Orthologs
Proteins
| thiol-disulfide oxidoreductase LTO1 | |
|---|---|
| Refseq ID | NP_567988 |
| Protein GI | 18419647 |
| UniProt ID | Q8L540 |
| mRNA ID | NM_119742 |
| Length | 376 |
| RefSeq Status | REVIEWED |
| MMARFVSVSSCQFHFGFREVSPPSVTSYPRRFEVSDRRFPAIPIKCSSSEPENGEDSAPSLSSSSSSSTSEVSTSNSSTYNWYTGIGGIGMLDTAYLTYLKVTGSDAFCPIGGGTCGDVLNSDYAVVFGVPLPVIGFVMYGVVTALSAELGEGNLPFGISKSNGRFALFGITTAMASASAYFLYILSTKLSGSSCLYCLVSAFLSFSLFFLSVKDVKLQEIQQVVGLQICLAIIVVASLTASYSTAQPIPSRSGDIELPYFRTEISSSSSPYAIALAKHLNSIGAKMYGAFWCSHCLEQKEMFGREAAKELNYVECFPDGYKKGTKILKACADAAIEGFPTWIINDKVLSGEIELAELAEMTGFSLDQANETNQLQ | |
Gene Information
Entrez Gene ID
Gene Name
thiol-disulfide oxidoreductase LTO1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IDA:TAIR | C | chloroplast |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0009536 | IDA:TAIR | C | plastid |
| GO:0009579 | IEA:UniProtKB-KW | C | thylakoid |
| GO:0003955 | IDA:TAIR | F | NAD(P)H dehydrogenase (quinone) activity |
| GO:0048038 | IEA:UniProtKB-KW | F | quinone binding |
| GO:0010207 | IMP:TAIR | P | photosystem II assembly |
Domain Information
UniProt Annotations
Entry Information
Gene Name
thiol-disulfide oxidoreductase LTO1
Protein Entry
LTO1_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Disruption Phenotype | Severe growth defects due to a limitation in the electron flow from PSII. {ECO:0000269|PubMed:22209765, ECO:0000269|PubMed:23689258}. |
| Function | Thiol-disulfide oxidoreductase catalyzing disulfide bond formation of chloroplast proteins and involved in redox regulation and photosynthetic electron transport. Required for the assembly of photosystem II (PSII) through the formation of disulfide bond in PSBO, a subunit of the PSII oxygen-evolving complex in the thylakoid lumen. Involved in the formation of disulfide bonds in the lumenal protein FKBP13. In vitro, reduces phylloquinone (vitamin K1) and menaquinone (vitamin K2) to their respective quinol. Cannot reduce phylloquinone epoxide to phylloquinone. {ECO:0000269|PubMed:20626653, ECO:0000269|PubMed:21781282, ECO:0000269|PubMed:22209765, ECO:0000269|PubMed:23689258}. |
| Sequence Caution | Sequence=AAM65737.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=CAA20046.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAB81485.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the VKOR family. {ECO:0000305}. |
| Subcellular Location | Plastid, chloroplast thylakoid membrane {ECO:0000305|PubMed:20626653, ECO:0000305|PubMed:21781282}; Multi- pass membrane protein {ECO:0000305|PubMed:20626653, ECO:0000305|PubMed:21781282}. |
| Subunit | Interacts with the PSII subunits PSBO1 and PSBO2. {ECO:0000269|PubMed:22209765}. |
| Tissue Specificity | Expressed in cotyledons, rosette leaves, stems, cauline leaves and flowers. {ECO:0000269|PubMed:20626653}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011353 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18419647 | RefSeq | NP_567988 | 376 | thiol-disulfide oxidoreductase LTO1 |
Identical Sequences to LMP011353 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18419647 | GenBank | AAM20579.1 | 376 | putative protein [Arabidopsis thaliana] |
| GI:18419647 | GenBank | AAM91303.1 | 376 | putative protein [Arabidopsis thaliana] |
| GI:18419647 | GenBank | AEE86559.1 | 376 | NAD(P)H dehydrogenase (quinone)s [Arabidopsis thaliana] |
| GI:18419647 | SwissProt | Q8L540.1 | 376 | RecName: Full=Thiol-disulfide oxidoreductase LTO1; AltName: Full=Protein LUMEN THIOL OXIDOREDUCTASE 1; AltName: Full=Vitamin K reductase; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP011353 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18419647 | GenBank | AAM65737.1 | 375 | unknown [Arabidopsis thaliana] |
| GI:18419647 | GenBank | EFH43316.1 | 375 | hypothetical protein ARALYDRAFT_491070 [Arabidopsis lyrata subsp. lyrata] |
| GI:18419647 | RefSeq | XP_002867057.1 | 375 | hypothetical protein ARALYDRAFT_491070 [Arabidopsis lyrata subsp. lyrata] |
| GI:18419647 | RefSeq | XP_006283933.1 | 378 | hypothetical protein CARUB_v10005052mg [Capsella rubella] |
| GI:18419647 | RefSeq | XP_010432235.1 | 374 | PREDICTED: thiol-disulfide oxidoreductase LTO1-like [Camelina sativa] |
| GI:18419647 | RefSeq | XP_010446882.1 | 374 | PREDICTED: thiol-disulfide oxidoreductase LTO1 [Camelina sativa] |