Gene/Proteome Database (LMPD)
LMPD ID
LMP011425
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
UDP-glycosyltransferase 73C5
Gene Symbol
Synonyms
don-glucosyltransferase 1; F13K3.20; F13K3_20; UDP-GLUCOSYL TRANSFERASE 73C5; UGT73C5
Alternate Names
UDP-glycosyltransferase 73C5
Chromosome
2
EC Number
2.4.1.-
Summary
Encodes a DON-Glucosyltransferase. The UGT73C5 glucosylates both brassinolide and castasterone in the 23-O position. The enzyme is presumably involved in the homeostasis of those steroid hormones hence regulating BR activity. Transgenic plants overexpressing UGT73C5 show a typical BR-deficient phenotype.
Orthologs
Proteins
| UDP-glycosyltransferase 73C5 | |
|---|---|
| Refseq ID | NP_181218 |
| Protein GI | 15228037 |
| UniProt ID | Q9ZQ94 |
| mRNA ID | NM_129235 |
| Length | 495 |
| RefSeq Status | REVIEWED |
| MVSETTKSSPLHFVLFPFMAQGHMIPMVDIARLLAQRGVIITIVTTPHNAARFKNVLNRAIESGLPINLVQVKFPYLEAGLQEGQENIDSLDTMERMIPFFKAVNFLEEPVQKLIEEMNPRPSCLISDFCLPYTSKIAKKFNIPKILFHGMGCFCLLCMHVLRKNREILDNLKSDKELFTVPDFPDRVEFTRTQVPVETYVPAGDWKDIFDGMVEANETSYGVIVNSFQELEPAYAKDYKEVRSGKAWTIGPVSLCNKVGADKAERGNKSDIDQDECLKWLDSKKHGSVLYVCLGSICNLPLSQLKELGLGLEESQRPFIWVIRGWEKYKELVEWFSESGFEDRIQDRGLLIKGWSPQMLILSHPSVGGFLTHCGWNSTLEGITAGLPLLTWPLFADQFCNEKLVVEVLKAGVRSGVEQPMKWGEEEKIGVLVDKEGVKKAVEELMGESDDAKERRRRAKELGDSAHKAVEEGGSSHSNISFLLQDIMELAEPNN | |
Gene Information
Entrez Gene ID
Gene Name
UDP-glycosyltransferase 73C5
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0050502 | IDA:TAIR | F | cis-zeatin O-beta-D-glucosyltransferase activity |
| GO:0046527 | IDA:TAIR | F | glucosyltransferase activity |
| GO:0080046 | IDA:TAIR | F | quercetin 4'-O-glucosyltransferase activity |
| GO:0080044 | IDA:TAIR | F | quercetin 7-O-glucosyltransferase activity |
| GO:0050403 | IDA:TAIR | F | trans-zeatin O-beta-D-glucosyltransferase activity |
| GO:0016131 | IDA:TAIR | P | brassinosteroid metabolic process |
KEGG Pathway Links
BIOCYC Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002213 | UDP-glucuronosyl/UDP-glucosyltransferase |
UniProt Annotations
Entry Information
Gene Name
UDP-glycosyltransferase 73C5
Protein Entry
U73C5_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Function | Specifically catalyzes 23-O-glucosylation of brassinosteroids, resulting probably in their inactivation. Also, involved in the O-glucosylation of trans-zeatin and dihydrozeatin. Active in vitro on cis-zeatin, dihydrozeatin-9-N-Glc, and olomoucine. Also involved in the detoxification of the Fusarium mycotoxin deoxynivalenol by the transfer of glucose from UDP- glucose to the hydroxyl group at C-3. Possesses low quercetin 7-O- glucosyltransferase and 4'-O-glucosyltransferase activities in vitro. {ECO:0000269|PubMed:12970342, ECO:0000269|PubMed:15342621, ECO:0000269|PubMed:15352060, ECO:0000269|PubMed:16214889}. |
| Induction | Rapidly induced in response to deoxynivalenol exposure. Weak induction by salicylic acid, jasmonic acid and 1- aminocyclopropylcarbonic acid (ACC) treatments. Not induced by cytokinin treatment. {ECO:0000269|PubMed:12970342, ECO:0000269|PubMed:15342621}. |
| Similarity | Belongs to the UDP-glycosyltransferase family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. |
| Tissue Specificity | Elongating hypocotyls and root-specific. Expressed in the vascular system, in meristematic tissues of the root tip, and in the vasculature of the hypocotyl right after germination. In late stage of flower development, expressed in petals, and in abscission zones. {ECO:0000269|PubMed:12970342, ECO:0000269|PubMed:16214889}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011425 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15228037 | RefSeq | NP_181218 | 495 | UDP-glycosyltransferase 73C5 |
Identical Sequences to LMP011425 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15228037 | GenBank | ACW99424.1 | 495 | Sequence 20424 from patent US 7569389 |
| GI:15228037 | GenBank | ACX18853.1 | 495 | Sequence 46829 from patent US 7569389 |
| GI:15228037 | GenBank | ADF09415.1 | 495 | Sequence 29 from patent US 7662583 |
| GI:15228037 | GenBank | ADT59880.1 | 495 | Sequence 650 from patent US 7847156 |
| GI:15228037 | GenBank | AEC09299.1 | 495 | UDP-glycosyltransferase 73C5 [Arabidopsis thaliana] |
| GI:15228037 | GenBank | AHL38805.1 | 495 | glycosyltransferase, partial [Arabidopsis thaliana] |
Related Sequences to LMP011425 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15228037 | GenBank | EFH57728.1 | 496 | don-glucosyltransferase [Arabidopsis lyrata subsp. lyrata] |
| GI:15228037 | RefSeq | XP_002881469.1 | 496 | don-glucosyltransferase [Arabidopsis lyrata subsp. lyrata] |
| GI:15228037 | RefSeq | XP_010500378.1 | 495 | PREDICTED: UDP-glycosyltransferase 73C6-like [Camelina sativa] |
| GI:15228037 | RefSeq | XP_010516907.1 | 495 | PREDICTED: UDP-glycosyltransferase 73C5-like [Camelina sativa] |
| GI:15228037 | RefSeq | XP_010461668.1 | 501 | PREDICTED: UDP-glycosyltransferase 73C5-like [Camelina sativa] |
| GI:15228037 | RefSeq | XP_010479272.1 | 495 | PREDICTED: UDP-glycosyltransferase 73C5 [Camelina sativa] |