Gene/Proteome Database (LMPD)
Proteins
| very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 | |
|---|---|
| Refseq ID | NP_001190277 |
| Protein GI | 334187585 |
| UniProt ID | F4KGW0 |
| mRNA ID | NM_001203348 |
| Length | 230 |
| RefSeq Status | REVIEWED |
| MAGFLSVVRRVYLTLYNWIVFAGWAQVLYLAITTLKETGYENVYDAIEKPLQLAQTAAVLEILHGLVGLVRSPVSATLPQIGSRLFLTWGILYSFPEVRSHFLVTSLVISWSITEFPITTWIVEIIRYSFFGFKEALGFAPSWHLWLRYSSFLLLYPTGITSEVGLIYLALPHIKTSEMYSVRMPNILNFSFDFFYATILVLAIYVPGSPHMYRYMLGQRKRALSKSKRE | |
| very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 | |
|---|---|
| Refseq ID | NP_196610 |
| Protein GI | 22326707 |
| UniProt ID | Q8VZB2 |
| mRNA ID | NM_121086 |
| Length | 221 |
| RefSeq Status | REVIEWED |
| MAGFLSVVRRVYLTLYNWIVFAGWAQVLYLAITTLKETGYENVYDAIEKPLQLAQTAAVLEILHGLVGLVRSPVSATLPQIGSRLFLTWGILYSFPEVRSHFLVTSLVISWSITEIIRYSFFGFKEALGFAPSWHLWLRYSSFLLLYPTGITSEVGLIYLALPHIKTSEMYSVRMPNILNFSFDFFYATILVLAIYVPGSPHMYRYMLGQRKRALSKSKRE | |
| very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 | |
|---|---|
| Refseq ID | NP_001078566 |
| Protein GI | 145334369 |
| UniProt ID | Q8VZB2 |
| mRNA ID | NM_001085097 |
| Length | 196 |
| RefSeq Status | REVIEWED |
| MVLYLAITTLKETGYENVYDAIEKPLQLAQTAAVLEILHGLVGLVRSPVSATLPQIGSRLFLTWGILYSFPEVRSHFLVTSLVISWSITEIIRYSFFGFKEALGFAPSWHLWLRYSSFLLLYPTGITSEVGLIYLALPHIKTSEMYSVRMPNILNFSFDFFYATILVLAIYVPGSPHMYRYMLGQRKRALSKSKRE | |
Gene Information
Entrez Gene ID
Gene Name
very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0016829 | IEA:UniProtKB-KW | F | lyase activity |
| GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
| GO:0007275 | IEA:UniProtKB-KW | P | multicellular organismal development |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath01110 | Biosynthesis of secondary metabolites |
| ath01040 | Biosynthesis of unsaturated fatty acids |
| ko01040 | Biosynthesis of unsaturated fatty acids |
| ath_M00415 | Fatty acid biosynthesis, elongation, endoplasmic reticulum |
| M00415 | Fatty acid biosynthesis, elongation, endoplasmic reticulum |
| ath00062 | Fatty acid elongation |
| ko00062 | Fatty acid elongation |
| ath01212 | Fatty acid metabolism |
| ko01212 | Fatty acid metabolism |
| ath01100 | Metabolic pathways |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-6435 | 4-hydroxybenzoate biosynthesis V |
| PWY-5136 | fatty acid beta-oxidation II (peroxisome) |
| ILEUDEG-PWY | isoleucine degradation I |
| PWY-735 | jasmonic acid biosynthesis |
| PWY-561 | superpathway of glyoxylate cycle and fatty acid degradation |
| PWY-5138 | unsaturated, even numbered fatty acid beta-oxidation |
| VALDEG-PWY | valine degradation I |
| PWY-5080 | very long chain fatty acid biosynthesis I |
| PWY-5080 | very long chain fatty acid biosynthesis I |
| PWY-7036 | very long chain fatty acid biosynthesis II |
| PWY-7036 | very long chain fatty acid biosynthesis II |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007482 | Protein-tyrosine phosphatase-like, PTPLA |
UniProt Annotations
Entry Information
Gene Name
very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2
Protein Entry
PAS2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8VZB2-1; Sequence=Displayed; Name=2; IsoId=Q8VZB2-2; Sequence=VSP_037155, VSP_037156; Note=Derived from EST data. No experimental confirmation available.; |
| Catalytic Activity | A very-long-chain (3R)-3-hydroxyacyl-CoA = a very-long-chain trans-2,3-dehydroacyl-CoA + H(2)O. |
| Caution | Shares some similarity with tyrosine phosphatase proteins but it has probably no phosphatase activity since the potential active site Cys residue in position 65 is replaced by Gly. {ECO:0000305}. |
| Disruption Phenotype | Embryo lethal when homozygote. {ECO:0000269|PubMed:18799749, ECO:0000269|PubMed:21896643}. |
| Function | Responsible for the dehydration step in very long-chain fatty acid (VLCFA) synthesis. May be an anti-phosphatase that prevents CDKA-1 dephosphorylation and activation. Involved in the hormonal control of cell division and differentiation. Required for proliferation control of meristematic and non-meristematic cells. Negative regulator of the cell cycle. {ECO:0000269|PubMed:12459923, ECO:0000269|PubMed:12472687, ECO:0000269|PubMed:12857804, ECO:0000269|PubMed:16698944, ECO:0000269|PubMed:18799749, ECO:0000269|PubMed:21896643}. |
| Miscellaneous | Plants with reduced exprssion of PAS2 show impaired embryo and seedling development associated with cell de- differentiation and proliferation. Root growth is reduced, due to a delay in cell plate establishment during cytokinesis (PubMed:21896643). {ECO:0000305|PubMed:21896643}. |
| Pathway | Lipid metabolism; fatty acid biosynthesis. |
| Sequence Caution | Sequence=CAB89395.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the very long-chain fatty acids dehydratase HACD family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Cytoplasm. Nucleus. Note=Found in the cytoplasm of dividing cells but moves into the nucleus upon cell differentiation. |
| Subunit | Interacts with CDKA-1; but only with the 'Tyr-15' phosphorylated protein. Interacts with PAS1. Part of the fatty acid elongase complex which contains a beta-ketoacyl-CoA synthase (KCS), a beta-ketoacyl-CoA reductase (KCR), a beta-hydroxyacyl-CoA dehydratase (HCD) and an enoyl-CoA reductase (ECR) (Probable). {ECO:0000305|PubMed:16698944, ECO:0000305|PubMed:20145257}. |
| Tissue Specificity | High expression in young seedlings, roots, root tips, flowers and young siliques. Lower levels in leaves and stems. {ECO:0000269|PubMed:12472687, ECO:0000269|PubMed:21896643}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011436 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 334187585 | RefSeq | NP_001190277 | 230 | very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 |
| 22326707 | RefSeq | NP_196610 | 221 | very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 |
| 145334369 | RefSeq | NP_001078566 | 196 | very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 |
Identical Sequences to LMP011436 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:22326707 | GenBank | AAP13377.1 | 221 | At5g10480 [Arabidopsis thaliana] |
| GI:22326707 | GenBank | AFX28415.1 | 221 | Sequence 9475 from patent US 8299318 |
| GI:22326707 | GenBank | AFX49078.1 | 221 | Sequence 50911 from patent US 8299318 |
| GI:22326707 | GenBank | AGF13663.1 | 221 | Sequence 13082 from patent US 8362325 |
| GI:22326707 | gnl | TAIR | 221 | very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 [Arabidopsis thaliana] |
| GI:145334369 | gnl | TAIR | 196 | very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 [Arabidopsis thaliana] |
| GI:334187585 | gnl | TAIR | 230 | very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 [Arabidopsis thaliana] |
| GI:22326707 | SwissProt | Q8VZB2.1 | 221 | RecName: Full=Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2; AltName: Full=3-hydroxyacyl-CoA dehydratase PASTICCINO 2; Short=AtPAS2; Short=HACD; Short=HCD; AltName: Full=Protein PEPINO; Short=PEP; AltName: Full=Protein tyrosine phosphatase-like protein [Arabidopsis thaliana] |
Related Sequences to LMP011436 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:334187585 | EMBL | CAD45041.1 | 221 | PEPINO protein [Arabidopsis thaliana] |
| GI:145334369 | GenBank | AAL38266.1 | 221 | putative protein phosphatase [Arabidopsis thaliana] |
| GI:334187585 | GenBank | AAL05403.1 | 221 | PASTICCINO2 [Arabidopsis thaliana] |
| GI:334187585 | GenBank | AAP13377.1 | 221 | At5g10480 [Arabidopsis thaliana] |
| GI:145334369 | GenBank | AAP13377.1 | 221 | At5g10480 [Arabidopsis thaliana] |
| GI:22326707 | GenBank | EFH49720.1 | 221 | hypothetical protein ARALYDRAFT_909004 [Arabidopsis lyrata subsp. lyrata] |
| GI:145334369 | GenBank | AFX28415.1 | 221 | Sequence 9475 from patent US 8299318 |
| GI:334187585 | GenBank | AFX28415.1 | 221 | Sequence 9475 from patent US 8299318 |
| GI:145334369 | GenBank | AFX49078.1 | 221 | Sequence 50911 from patent US 8299318 |
| GI:334187585 | GenBank | AFX49078.1 | 221 | Sequence 50911 from patent US 8299318 |
| GI:145334369 | GenBank | AGF13663.1 | 221 | Sequence 13082 from patent US 8362325 |
| GI:334187585 | gnl | TAIR | 221 | very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 [Arabidopsis thaliana] |
| GI:22326707 | gnl | TAIR | 230 | very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 [Arabidopsis thaliana] |
| GI:145334369 | RefSeq | NP_196610.2 | 221 | very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 [Arabidopsis thaliana] |
| GI:22326707 | RefSeq | XP_002873461.1 | 221 | hypothetical protein ARALYDRAFT_909004 [Arabidopsis lyrata subsp. lyrata] |
| GI:22326707 | RefSeq | NP_001190277.1 | 230 | very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase PASTICCINO 2 [Arabidopsis thaliana] |
| GI:22326707 | RefSeq | XP_010453074.1 | 221 | PREDICTED: very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2-like [Camelina sativa] |
| GI:22326707 | RefSeq | XP_010491719.1 | 221 | PREDICTED: very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2 [Camelina sativa] |