Gene/Proteome Database (LMPD)
LMPD ID
LMP011443
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Gene Symbol
Synonyms
T20P8.18; T20P8_18
Alternate Names
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Chromosome
2
Proteins
| bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | |
|---|---|
| Refseq ID | NP_565637 |
| Protein GI | 18401329 |
| UniProt ID | Q9ZVC7 |
| mRNA ID | NM_128271 |
| Length | 176 |
| RefSeq Status | REVIEWED |
| MLTTNTLAVLLLLFLSLCSGQSPPAPEPIAADGPSSPVNCLVSMLNVSDCFSYVQVGSNEIKPEAACCPELAGMVQSSPECVCNLYGGGASPRFGVKLDKQRAEQLSTICGVKAPSPSLCSVLGFPTISPAGSEDSSSGSEGSDKDKKNGAMTTKYCGVALNSLALLLLFTFLSLS | |
Gene Information
Entrez Gene ID
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031225 | TAS:TAIR | C | anchored component of membrane |
| GO:0046658 | IDA:TAIR | C | anchored component of plasma membrane |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR016140 | Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain |
UniProt Annotations
Entry Information
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Protein Entry
XYP11_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the plant LTP family. {ECO:0000305}. |
| Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011443 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18401329 | RefSeq | NP_565637 | 176 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein |
Identical Sequences to LMP011443 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18401329 | DBBJ | BAD43593.1 | 176 | predicted GPI-anchored protein [Arabidopsis thaliana] |
| GI:18401329 | DBBJ | BAD43618.1 | 176 | predicted GPI-anchored protein [Arabidopsis thaliana] |
| GI:18401329 | DBBJ | BAD43623.1 | 176 | predicted GPI-anchored protein [Arabidopsis thaliana] |
| GI:18401329 | DBBJ | BAE73267.1 | 176 | xylogen like protein 11 [Arabidopsis thaliana] |
| GI:18401329 | GenBank | AEC07941.1 | 176 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:18401329 | SwissProt | Q9ZVC7.2 | 176 | RecName: Full=Xylogen-like protein 11; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP011443 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18401329 | GenBank | AAM67343.1 | 177 | unknown [Arabidopsis thaliana] |
| GI:18401329 | GenBank | EFH55322.1 | 174 | hypothetical protein ARALYDRAFT_481600 [Arabidopsis lyrata subsp. lyrata] |
| GI:18401329 | RefSeq | XP_002879063.1 | 174 | hypothetical protein ARALYDRAFT_481600 [Arabidopsis lyrata subsp. lyrata] |
| GI:18401329 | RefSeq | XP_010510810.1 | 177 | PREDICTED: xylogen-like protein 11 [Camelina sativa] |
| GI:18401329 | RefSeq | XP_010417860.1 | 177 | PREDICTED: xylogen-like protein 11 isoform X1 [Camelina sativa] |
| GI:18401329 | RefSeq | XP_010473103.1 | 178 | PREDICTED: xylogen-like protein 11 isoform X1 [Camelina sativa] |