Gene/Proteome Database (LMPD)

LMPD ID
LMP011444
Gene ID
835860
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
xyloglucan endotransglucosylase/hydrolase protein 22
Gene Symbol
TCH4
Synonyms
MUA2.13; MUA2_13; TCH4; Touch 4; XTH22; xyloglucan endotransglucosylase/hydrolase 22; XYLOGLUCAN ENDOTRANSGLYCOSYLASE
Alternate Names
xyloglucan endotransglucosylase/hydrolase protein 22
Chromosome
5
EC Number
2.4.1.207

Proteins

xyloglucan endotransglucosylase/hydrolase protein 22
Refseq ID NP_200564
Protein GI 15242781
UniProt ID Q38857
mRNA ID NM_125137
Length 284
RefSeq Status REVIEWED
MAITYLLPLFLSLIITSSVSANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKVSMQMKLVPGNSAGTVTTLYLKSPGTTWDEIDFEFLGNSSGEPYTLHTNVYTQGKGDKEQQFKLWFDPTANFHTYTILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKTDWSKAPFTASYRGFQQEACVWSNGKSSCPNASKQGTTTGSWLSQELDSTAQQRMRWVQRNYMIYNYCTDAKRFPQGLPKECLAA

Gene Information

Entrez Gene ID
835860
Gene Name
xyloglucan endotransglucosylase/hydrolase protein 22
Gene Symbol
TCH4
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:TAIR C Golgi apparatus
GO:0048046 IEA:UniProtKB-KW C apoplast
GO:0005618 IDA:TAIR C cell wall
GO:0004553 IEA:InterPro F hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016762 IDA:TAIR F xyloglucan:xyloglucosyl transferase activity
GO:0006073 IEA:InterPro P cellular glucan metabolic process
GO:0009664 TAS:TAIR P plant-type cell wall organization
GO:0009733 IEP:TAIR P response to auxin
GO:0009741 IEP:TAIR P response to brassinosteroid
GO:0009409 IEP:TAIR P response to cold
GO:0009408 IEP:TAIR P response to heat
GO:0009612 IEP:TAIR P response to mechanical stimulus

KEGG Pathway Links

KEGG Pathway ID Description
ath04075 Plant hormone signal transduction
ko04075 Plant hormone signal transduction

Domain Information

InterPro Annotations

Accession Description
IPR013320 Concanavalin A-like lectin/glucanase domain
IPR000757 Glycoside hydrolase, family 16
IPR008263 Glycoside hydrolase, family 16, active site
IPR010713 Xyloglucan endo-transglycosylase, C-terminal
IPR016455 Xyloglucan endotransglucosylase/hydrolase

UniProt Annotations

Entry Information

Gene Name
xyloglucan endotransglucosylase/hydrolase protein 22
Protein Entry
XTH22_ARATH
UniProt ID
Q38857
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties pH dependence: Optimum pH is 6.0-6.5.; Temperature dependence: Optimum temperature from 12 to 18 degrees Celsius. Cold tolerant.;
Catalytic Activity Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan. {ECO:0000269|PubMed:10406121}.
Function Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues. Its induction in case of mechanical stress, suggests that it may contribute in the adaptive changes in morphogenesis by being recruited to alter tissues tensil strength, or flexibility, enabling adaptation to mechanically stressful environments. {ECO:0000269|PubMed:7580251}.
Induction In response to mechanical perturbations such as wind or touch. Induced by auxin and brassinolide. {ECO:0000269|PubMed:11673616, ECO:0000269|PubMed:7580251, ECO:0000269|PubMed:8696366}.
Ptm Contains at least one intrachain disulfide bond essential for its enzymatic activity.
Ptm N-glycosylated; essential for its enzymatic activity. {ECO:0000269|PubMed:10406121, ECO:0000269|PubMed:9753780}.
Similarity Belongs to the glycosyl hydrolase 16 family. XTH group 2 subfamily. {ECO:0000305}.
Subcellular Location Secreted, cell wall {ECO:0000305}. Secreted, extracellular space, apoplast {ECO:0000305}.
Tissue Specificity Highly expressed. Predominantly expressed in green siliques. Expressed in young expanding leaves, trichomes, lateral root primordia, vascular tissue, abscission zones and elongating hypocols. Following wind stimulation, it decreases in the leaves of wind-stimulated plants, while it strongly increases in sites around cells of the pith parenchyma, between the vascular elements, and within the epidermis. {ECO:0000269|PubMed:11673616, ECO:0000269|PubMed:7580251, ECO:0000269|PubMed:9414546}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011444 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15242781 RefSeq NP_200564 284 xyloglucan endotransglucosylase/hydrolase protein 22

Identical Sequences to LMP011444 proteins

Reference Database Accession Length Protein Name
GI:15242781 EMBL CBD24844.1 284 unnamed protein product [Arabidopsis thaliana]
GI:15242781 GenBank AAL05902.1 284 AT5g57560/MUA2_13 [Arabidopsis thaliana]
GI:15242781 GenBank AAL38614.1 284 AT5g57560/MUA2_13 [Arabidopsis thaliana]
GI:15242781 GenBank ADT59886.1 284 Sequence 662 from patent US 7847156
GI:15242781 gnl TAIR 284 xyloglucan endotransglucosylase/hydrolase protein 22 [Arabidopsis thaliana]
GI:15242781 SwissProt Q38857.1 284 RecName: Full=Xyloglucan endotransglucosylase/hydrolase protein 22; Short=At-XTH22; Short=XTH-22; AltName: Full=Touch protein 4; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP011444 proteins

Reference Database Accession Length Protein Name
GI:15242781 GenBank EFH42472.1 282 hypothetical protein ARALYDRAFT_918931 [Arabidopsis lyrata subsp. lyrata]
GI:15242781 GenBank KFK27295.1 284 hypothetical protein AALP_AA8G363900 [Arabis alpina]
GI:15242781 RefSeq XP_002866213.1 282 hypothetical protein ARALYDRAFT_918931 [Arabidopsis lyrata subsp. lyrata]
GI:15242781 RefSeq XP_010452475.1 287 PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 22-like [Camelina sativa]
GI:15242781 RefSeq XP_010443442.1 287 PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 22 [Camelina sativa]
GI:15242781 RefSeq XP_010483278.1 287 PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 22 [Camelina sativa]