Gene/Proteome Database (LMPD)

LMPD ID
LMP011457
Gene ID
833972
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
homeobox protein 23
Gene Symbol
HB23
Synonyms
AtHB23; HB23; homeobox protein 23; MKM21.8; MKM21_8
Alternate Names
homeobox protein 23
Chromosome
5

Proteins

homeobox protein 23
Refseq ID NP_568570
Protein GI 18421904
UniProt ID Q9FIW9
mRNA ID NM_123338
Length 334
RefSeq Status REVIEWED
MMDMTPTITTTTTPTPKSPEPESETPTRIQPAKPISFSNGIIKRHHHHHHPLLFTYKECLKNHAAALGGHALDGCGEFMPSPSSISSDPTSLKCAACGCHRNFHRRDPDNNNDSSQIPPPPSTAVEYQPHHRHHPPPPPPPPPPRSPNSASPPPISSSYMLLSLSGTNNNNNNLASFSDLNFSAGNNHHHHHQHTLHGSRKRFRTKFSQFQKEKMHEFAERVGWKMQKRDEDDVRDFCRQIGVDKSVLKVWMHNNKNTFNRRDIAGNEIRQIDNGGGNHTPILAGEINNHNNGHHGVGGGGELHQSVSSGGGGGGFDSDSGGANGGNVNGSSSS

Gene Information

Entrez Gene ID
833972
Gene Name
homeobox protein 23
Gene Symbol
HB23
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005634 ISS:UniProtKB C nucleus
GO:0003677 ISS:TAIR F DNA binding
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0042803 IDA:UniProtKB F protein homodimerization activity
GO:0009740 IEA:UniProtKB-KW P gibberellic acid mediated signaling pathway
GO:0006355 IEA:UniProtKB-KW P regulation of transcription, DNA-templated
GO:0009739 IEP:UniProtKB P response to gibberellin
GO:0006351 IEA:UniProtKB-KW P transcription, DNA-templated

Domain Information

InterPro Annotations

Accession Description
IPR006455 Homeodomain, ZF-HD class
IPR009057 Homeodomain-like
IPR006456 ZF-HD homeobox protein, Cys/His-rich dimerisation domain

UniProt Annotations

Entry Information

Gene Name
homeobox protein 23
Protein Entry
ZHD10_ARATH
UniProt ID
Q9FIW9
Species
Arabidopsis

Comments

Comment Type Description
Developmental Stage In young leaves, accumulates in the adaxial domain of leaf primordia and the rib meristem. {ECO:0000269|PubMed:17387478}.
Domain The homeodomain differs form the typical one by having namely 4 instead of 3 extra amino acids inserted in the loop between helix 1 and helix 2.
Function Putative transcription factor. Probably involved in establishing polarity during leaf development through the gibberellic acid (GA) signaling pathway. {ECO:0000269|PubMed:17387478}.
Induction By gibberellic acid (GA). {ECO:0000269|PubMed:17387478}.
Interaction Q9FKP8:ZHD1; NbExp=3; IntAct=EBI-1806298, EBI-766685; Q9LXG0:ZHD8; NbExp=5; IntAct=EBI-1806298, EBI-1806405;
Sequence Caution Sequence=AAM64462.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Similarity Contains 1 ZF-HD dimerization-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00856}.
Similarity Contains 1 homeobox DNA-binding domain. {ECO:0000305}.
Subcellular Location Nucleus {ECO:0000250}. Note=Interactions with MIF proteins prevent nuclear subcellular location and leads to a scattered repartition throughout the cytoplasm. {ECO:0000250}.
Subunit Homo- and heterodimer with other ZFHD proteins. Interacts with MIF1, MIF2 and MIF3; these interactions prevent nuclear localization and DNA-binding to inhibit transcription regulation activity. Binds to ZHD1, ZHD2, ZHD4, ZHD5, ZHD6, ZHD7 and ZHD8. {ECO:0000269|PubMed:16428600, ECO:0000269|PubMed:21059647}.
Tissue Specificity Mostly expressed in rosettes (e.g. young leaves), flowers (e.g. styles), siliques and inflorescence. {ECO:0000269|PubMed:16428600, ECO:0000269|PubMed:17387478}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011457 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18421904 RefSeq NP_568570 334 homeobox protein 23

Identical Sequences to LMP011457 proteins

Reference Database Accession Length Protein Name
GI:18421904 GenBank ADS94287.1 334 Sequence 616 from patent US 7825296
GI:18421904 GenBank AEH75154.1 334 Sequence 294 from patent US 7956242
GI:18421904 GenBank AEI22999.1 334 Sequence 930 from patent US 7960612
GI:18421904 GenBank AEQ40850.1 334 Sequence 1778 from patent US 8030546
GI:18421904 GenBank AGX49378.1 334 Sequence 616 from patent US 8541665
GI:18421904 gnl TAIR 334 homeobox protein 23 [Arabidopsis thaliana]

Related Sequences to LMP011457 proteins

Reference Database Accession Length Protein Name
GI:18421904 DBBJ BAE99230.1 334 hypothetical protein [Arabidopsis thaliana]
GI:18421904 GenBank AAM64462.1 333 unknown [Arabidopsis thaliana]
GI:18421904 GenBank EFH47021.1 327 hypothetical protein ARALYDRAFT_494014 [Arabidopsis lyrata subsp. lyrata]
GI:18421904 RefSeq XP_002870762.1 327 hypothetical protein ARALYDRAFT_494014 [Arabidopsis lyrata subsp. lyrata]
GI:18421904 RefSeq XP_006285795.1 341 hypothetical protein CARUB_v10007269mg [Capsella rubella]
GI:18421904 RefSeq XP_010441087.1 342 PREDICTED: zinc-finger homeodomain protein 10 [Camelina sativa]