Gene/Proteome Database (LMPD)

LMPD ID
LMP011466
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
rhodopsin
Gene Symbol
Synonyms
Rh; RH1; zfo2; zfrho; fi06d11; wu:fi06d11
Alternate Names
rhodopsin; rod opsin; retinal rod opsin pigment rh1.1
Chromosome
8

Proteins

rhodopsin
Refseq ID NP_571159
Protein GI 18859317
UniProt ID P35359
mRNA ID NM_131084
Length 354
RefSeq Status PROVISIONAL
MNGTEGPAFYVPMSNATGVVRSPYEYPQYYLVAPWAYGFVAAYMFFLIITGFPVNFLTLYVTIEHKKLRTPLNYILLNLAIADLFMVFGGFTTTMYTSLHGYFVFGRLGCNLEGFFATLGGEMGLKSLVVLAIERWMVVCKPVSNFRFGENHAIMGVAFTWVMACSCAVPPLVGWSRYIPEGMQCSCGVDYYTRTPGVNNESFVIYMFIVHFFIPLIVIFFCYGRLVCTVKEAARQQQESETTQRAEREVTRMVIIMVIAFLICWLPYAGVAWYIFTHQGSEFGPVFMTLPAFFAKTSAVYNPCIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSSVSPA

Gene Information

Entrez Gene ID
Gene Name
rhodopsin
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0004930 IEA:UniProtKB-KW F G-protein coupled receptor activity
GO:0009881 NAS:UniProtKB F photoreceptor activity
GO:0016918 NAS:UniProtKB F retinal binding
GO:0018298 IEA:UniProtKB-KW P protein-chromophore linkage
GO:0016056 NAS:UniProtKB P rhodopsin mediated signaling pathway
GO:0007601 IEA:UniProtKB-KW P visual perception

KEGG Pathway Links

KEGG Pathway ID Description
dre04744 Phototransduction

REACTOME Pathway Links

REACTOME Pathway ID Description
6176487 G alpha (i) signalling events
6176579 Opsins

Domain Information

InterPro Annotations

Accession Description
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM
IPR001760 Opsin
IPR000732 Rhodopsin
IPR019477 Rhodopsin, N-terminal
IPR027430 Visual pigments (opsins) retinal binding site

UniProt Annotations

Entry Information

Gene Name
rhodopsin
Protein Entry
OPSD_DANRE
UniProt ID
Species
Zebrafish

Comments

Comment Type Description
Caution Was originally (PubMed:8327475 and PubMed:8924413) thought to be an ultraviolet-sensitive opsin present in short single cones. {ECO:0000305}.
Developmental Stage First detected at 51 hours post-fertilization (hpf) in the ventral retina. At 60 hpf, expressed in a strip across the ventrotemporal retina. By 96 hpf, also expressed in the dorsal retina. {ECO:0000269|PubMed:8924413}.
Function Visual pigments such as rhodopsin and porphyropsin are light-absorbing molecules that mediate vision. Rhodopsin consists of an apoprotein, opsin, covalently linked to 11-cis-retinal. This receptor is coupled to the activation of phospholipase C. Porphyropsin consists of opsin covalently linked to 11-cis 3,4- didehydroretinal.
Ptm Phosphorylated on some or all of the serine and threonine residues present in the C-terminal region. {ECO:0000250}.
Similarity Belongs to the G-protein coupled receptor 1 family. Opsin subfamily. {ECO:0000255|PROSITE-ProRule:PRU00521}.
Subcellular Location Membrane; Multi-pass membrane protein.
Tissue Specificity Retinal rod photoreceptor cells, predominantly in the outer segments. {ECO:0000269|PubMed:10349976, ECO:0000269|PubMed:8327475, ECO:0000269|PubMed:8603882}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011466 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18859317 RefSeq NP_571159 354 rhodopsin

Identical Sequences to LMP011466 proteins

Reference Database Accession Length Protein Name
GI:18859317 GenBank AAA85566.1 354 unknown opsin-like protein [Danio rerio]
GI:18859317 GenBank AAD14679.1 354 rhodopsin [Danio rerio]

Related Sequences to LMP011466 proteins

Reference Database Accession Length Protein Name
GI:18859317 DBBJ BAC21668.1 354 rod opsin [Danio rerio]
GI:18859317 GenBank AAD24751.1 354 rhodopsin [Danio rerio]
GI:18859317 GenBank AAK01136.1 354 light receptor rod opsin [Danio rerio]
GI:18859317 GenBank AAH63938.1 354 Rhodopsin [Danio rerio]
GI:18859317 GenBank ADK38856.1 354 retinal rod opsin pigment rh1.1 [Danio rerio]
GI:18859317 SwissProt P35359.2 354 RecName: Full=Rhodopsin [Danio rerio]