Gene/Proteome Database (LMPD)
Proteins
rhodopsin | |
---|---|
Refseq ID | NP_571159 |
Protein GI | 18859317 |
UniProt ID | P35359 |
mRNA ID | NM_131084 |
Length | 354 |
RefSeq Status | PROVISIONAL |
MNGTEGPAFYVPMSNATGVVRSPYEYPQYYLVAPWAYGFVAAYMFFLIITGFPVNFLTLYVTIEHKKLRTPLNYILLNLAIADLFMVFGGFTTTMYTSLHGYFVFGRLGCNLEGFFATLGGEMGLKSLVVLAIERWMVVCKPVSNFRFGENHAIMGVAFTWVMACSCAVPPLVGWSRYIPEGMQCSCGVDYYTRTPGVNNESFVIYMFIVHFFIPLIVIFFCYGRLVCTVKEAARQQQESETTQRAEREVTRMVIIMVIAFLICWLPYAGVAWYIFTHQGSEFGPVFMTLPAFFAKTSAVYNPCIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSSVSPA |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0004930 | IEA:UniProtKB-KW | F | G-protein coupled receptor activity |
GO:0009881 | NAS:UniProtKB | F | photoreceptor activity |
GO:0016918 | NAS:UniProtKB | F | retinal binding |
GO:0018298 | IEA:UniProtKB-KW | P | protein-chromophore linkage |
GO:0016056 | NAS:UniProtKB | P | rhodopsin mediated signaling pathway |
GO:0007601 | IEA:UniProtKB-KW | P | visual perception |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
dre04744 | Phototransduction |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Caution | Was originally (PubMed:8327475 and PubMed:8924413) thought to be an ultraviolet-sensitive opsin present in short single cones. {ECO:0000305}. |
Developmental Stage | First detected at 51 hours post-fertilization (hpf) in the ventral retina. At 60 hpf, expressed in a strip across the ventrotemporal retina. By 96 hpf, also expressed in the dorsal retina. {ECO:0000269|PubMed:8924413}. |
Function | Visual pigments such as rhodopsin and porphyropsin are light-absorbing molecules that mediate vision. Rhodopsin consists of an apoprotein, opsin, covalently linked to 11-cis-retinal. This receptor is coupled to the activation of phospholipase C. Porphyropsin consists of opsin covalently linked to 11-cis 3,4- didehydroretinal. |
Ptm | Phosphorylated on some or all of the serine and threonine residues present in the C-terminal region. {ECO:0000250}. |
Similarity | Belongs to the G-protein coupled receptor 1 family. Opsin subfamily. {ECO:0000255|PROSITE-ProRule:PRU00521}. |
Subcellular Location | Membrane; Multi-pass membrane protein. |
Tissue Specificity | Retinal rod photoreceptor cells, predominantly in the outer segments. {ECO:0000269|PubMed:10349976, ECO:0000269|PubMed:8327475, ECO:0000269|PubMed:8603882}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011466 (as displayed in Record Overview)
Identical Sequences to LMP011466 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18859317 | GenBank | AAA85566.1 | 354 | unknown opsin-like protein [Danio rerio] |
GI:18859317 | GenBank | AAD14679.1 | 354 | rhodopsin [Danio rerio] |
Related Sequences to LMP011466 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18859317 | DBBJ | BAC21668.1 | 354 | rod opsin [Danio rerio] |
GI:18859317 | GenBank | AAD24751.1 | 354 | rhodopsin [Danio rerio] |
GI:18859317 | GenBank | AAK01136.1 | 354 | light receptor rod opsin [Danio rerio] |
GI:18859317 | GenBank | AAH63938.1 | 354 | Rhodopsin [Danio rerio] |
GI:18859317 | GenBank | ADK38856.1 | 354 | retinal rod opsin pigment rh1.1 [Danio rerio] |
GI:18859317 | SwissProt | P35359.2 | 354 | RecName: Full=Rhodopsin [Danio rerio] |