Gene/Proteome Database (LMPD)
Proteins
apolipoprotein Eb precursor | |
---|---|
Refseq ID | NP_571173 |
Protein GI | 18858283 |
UniProt ID | O42364 |
mRNA ID | NM_131098 |
Length | 281 |
RefSeq Status | PROVISIONAL |
MRSLVVFFALAVLTGCQARSLFQADAPQPRWEEMVDRFWQYVSELNTQTDGMVQNIKGSQLSRELDTLITDTMAELSSYSENLQTQMTPYASDAAGQLSKDLQLLAGKLQTDMTDAKERSTQYLQELKTMMEQNADDVKNRVGTYTRKLKKRLNKDTEEIRNTVATYMSEMQSRASQNADAVKDRFQPYMSQAQDGATQKLGAISELMKAQAQEVSEQLEVQAGALKEKLEETAENLRTSLEGRVDELTSLLAPYSQKIREQLQEVMDKIKEATAALPTQA |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
GO:0008289 | IEA:InterPro | F | lipid binding |
GO:0006869 | IEA:UniProtKB-KW | P | lipid transport |
GO:0042157 | IEA:InterPro | P | lipoprotein metabolic process |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR000074 | Apolipoprotein A/E |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Developmental Stage | Highly expressed in the yolk syncytial layer during embryonic (starting at the blastula stage) and early larval development, an extraembryonic structure implicated in embryonic and larval nutrition. Also observed in the deep cell layer during blastula stage, in numerous ectodermal derivatives after gastrulation, and after 3 days of development in a limited number of cells both in brain and in the eyes. |
Function | Associated with several classes of plasma lipoproteins, it mediates uptake of lipoproteins through its ability to interact with specific cell surface receptors. |
Similarity | Belongs to the apolipoprotein A1/A4/E family. {ECO:0000305}. |
Subcellular Location | Secreted. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011469 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
18858283 | RefSeq | NP_571173 | 281 | apolipoprotein Eb precursor |
Identical Sequences to LMP011469 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18858283 | EMBL | CAA74003.1 | 281 | apolipoprotein E precursor protein [Danio rerio] |
GI:18858283 | EMBL | CAB64946.1 | 281 | apolipoprotein E precursor protein [Danio rerio] |
GI:18858283 | GenBank | AAH65592.1 | 281 | Apolipoprotein Eb [Danio rerio] |
GI:18858283 | RefSeq | XP_005158143.1 | 281 | PREDICTED: apolipoprotein Eb isoform X1 [Danio rerio] |
GI:18858283 | SwissProt | O42364.1 | 281 | RecName: Full=Apolipoprotein Eb; Short=Apo-Eb; Flags: Precursor [Danio rerio] |
Related Sequences to LMP011469 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18858283 | GenBank | AAI54035.1 | 281 | Apoeb protein [Danio rerio] |
GI:18858283 | GenBank | ACI15893.1 | 281 | apolipoprotein E-2 [Hemibarbus mylodon] |
GI:18858283 | GenBank | AEX91932.1 | 281 | apolipoprotein E [Carassius auratus x Cyprinus carpio] |
GI:18858283 | GenBank | AEX91934.1 | 281 | apolipoprotein E [Cyprinus carpio] |
GI:18858283 | GenBank | AFI92850.1 | 281 | apolipoprotein E [Cyprinus carpio] |
GI:18858283 | GenBank | AFI92851.1 | 281 | apolipoprotein E [Cyprinus carpio] |