Gene/Proteome Database (LMPD)

LMPD ID
LMP011486
Gene ID
30682
Species
Danio rerio (Zebrafish)
Gene Name
vascular endothelial growth factor Aa
Gene Symbol
vegfaa
Synonyms
vegf; vegfa; wu:fj82c06
Chromosome
16

Proteins

vascular endothelial growth factor A-A isoform 1 precursor
Refseq ID NP_571483
Protein GI 18859545
UniProt ID O73682
mRNA ID NM_131408
Length 188
RefSeq Status VALIDATED
MNLVVYLIQLFLAALLHLSAVKAAHIPKEGGKSKNDVIPFMDVYKKSACKTRELLVDIIQEYPDEIEHTYIPSCVVLMRCAGCCNDEALECVPTETRNVTMEVLRVKQRVSQHNFQLSFTEHTKCECRPKAEVKAKKENHCEPCSERRKRLYVQDPLTCKCSCKFTQMQCKSRQLELNERTCRCEKPR
vascular endothelial growth factor A-A isoform 2 precursor
Refseq ID NP_001103819
Protein GI 167736373
UniProt ID O73682
mRNA ID NM_001110349
Length 144
RefSeq Status VALIDATED
MNLVVYLIQLFLAALLHLSAVKAAHIPKEGGKSKNDVIPFMDVYKKSACKTRELLVDIIQEYPDEIEHTYIPSCVVLMRCAGCCNDEALECVPTETRNVTMEVLRVKQRVSQHNFQLSFTEHTKCECRPKAEVKAKKERCEKPR

Gene Information

Entrez Gene ID
30682
Gene Name
vascular endothelial growth factor Aa
Gene Symbol
vegfaa
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IDA:UniProtKB C extracellular region
GO:0016020 IEA:InterPro C membrane
GO:0008083 IMP:UniProtKB F growth factor activity
GO:0008201 IEA:InterPro F heparin binding
GO:0005172 NAS:UniProtKB F vascular endothelial growth factor receptor binding
GO:0007202 IDA:ZFIN P activation of phospholipase C activity
GO:0035479 IMP:ZFIN P angioblast cell migration from lateral mesoderm to midline
GO:0001525 IMP:UniProtKB P angiogenesis
GO:0048844 IMP:ZFIN P artery morphogenesis
GO:0001568 IMP:ZFIN P blood vessel development
GO:0002043 IDA:ZFIN P blood vessel endothelial cell proliferation involved in sprouting angiogenesis
GO:0003262 IGI:ZFIN P endocardial progenitor cell migration to the midline involved in heart field formation
GO:0030097 IMP:UniProtKB P hemopoiesis
GO:0008045 IGI:ZFIN P motor neuron axon guidance
GO:0001569 IMP:ZFIN P patterning of blood vessels
GO:0016310 IDA:UniProtKB P phosphorylation
GO:0045766 IMP:ZFIN P positive regulation of angiogenesis
GO:0051781 IEA:UniProtKB-KW P positive regulation of cell division
GO:0001938 ISS:UniProtKB P positive regulation of endothelial cell proliferation
GO:0051894 ISS:UniProtKB P positive regulation of focal adhesion assembly
GO:0050731 ISS:UniProtKB P positive regulation of peptidyl-tyrosine phosphorylation
GO:0031334 ISS:UniProtKB P positive regulation of protein complex assembly
GO:0048793 IMP:ZFIN P pronephros development
GO:0043491 IDA:ZFIN P protein kinase B signaling
GO:0035477 IMP:ZFIN P regulation of angioblast cell migration involved in selective angioblast sprouting
GO:0008016 IMP:ZFIN P regulation of heart contraction
GO:1901342 IGI:ZFIN P regulation of vasculature development
GO:0002040 IMP:ZFIN P sprouting angiogenesis
GO:0030878 IMP:ZFIN P thyroid gland development
GO:0048010 IGI:ZFIN P vascular endothelial growth factor receptor signaling pathway
GO:0001944 IMP:ZFIN P vasculature development
GO:0001570 IMP:UniProtKB P vasculogenesis

Domain Information

InterPro Annotations

Accession Description
IPR029034 Cystine-knot_cytokine
IPR000072 PDGF/VEGF_dom
IPR023581 PD_growth_factor_CS
IPR027928 VEGF_C

UniProt Annotations

Entry Information

Gene Name
vascular endothelial growth factor Aa
Protein Entry
O73682_DANRE
UniProt ID
O73682
Species
Zebrafish

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=VEGF165 ; IsoId=O73682-1; Sequence=Displayed; Name=VEGF121 ; IsoId=O73682-2; Sequence=VSP_050737;
Developmental Stage Expressed both maternally and zygotically. Present throughout embryonic development, and in adults.
Function Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis, and induces permeabilization of blood vessels. Acts both upstream of kdr and tie1 to stimulate endothelial cell differentiation, and upstream of gata1 to stimulate hematopoietic cell differentiation. {ECO:0000250|UniProtKB:P15692, ECO:0000269|PubMed:11578859, ECO:0000269|PubMed:17698971}.
Similarity Belongs to the PDGF/VEGF growth factor family.
Subcellular Location Secreted .
Subunit Homodimer; disulfide-linked (By similarity). Isoform VEGF165 binds kdr and kdrl.
Tissue Specificity Predominantly expressed in regions associated with active vascularization. From 15-16 hours post-fertilization (hpf), expressed in the anterior forebrain, the mesoderm underlying and lateral to the anterior hindbrain, the mesoderm underlying and lateral to the posterior hindbrain, and in the ventral medial portions of the somites. By 30-36 hpf, expression in the somites is decreased, while strong expression is observed in the region of the developing glomeruli and in the anterior portion of the pronephric ducts, the pharyngeal arches, and the brain. By 72 hpf, expression remains only in the pronephros region.

Identical and Related Proteins

Unique RefSeq proteins for LMP011486 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18859545 RefSeq NP_571483 188 vascular endothelial growth factor A-A isoform 1 precursor
167736373 RefSeq NP_001103819 144 vascular endothelial growth factor A-A isoform 2 precursor

Identical Sequences to LMP011486 proteins

Reference Database Accession Length Protein Name
GI:18859545 GenBank AAC41274.1 188 vascular endothelial growth factor isoform 165 [Danio rerio]
GI:167736373 GenBank AAC14713.1 144 vascular endothelial growth factor 121 isoform [Danio rerio]
GI:18859545 GenBank AAI62588.1 188 Vascular endothelial growth factor Aa [Danio rerio]
GI:18859545 GenBank AAI62258.1 188 Vascular endothelial growth factor Aa [Danio rerio]
GI:18859545 SwissProt O73682.1 188 RecName: Full=Vascular endothelial growth factor A-A; Short=VEGF-A-A; Flags: Precursor [Danio rerio]

Related Sequences to LMP011486 proteins

Reference Database Accession Length Protein Name
GI:18859545 EMBL CAG30564.1 190 vascular endothelial growth factor precursor [Oncorhynchus mykiss]
GI:18859545 EMBL CDQ72646.1 190 unnamed protein product [Oncorhynchus mykiss]
GI:167736373 GenBank AAC41274.1 188 vascular endothelial growth factor isoform 165 [Danio rerio]
GI:18859545 GenBank AAC14713.1 144 vascular endothelial growth factor 121 isoform [Danio rerio]
GI:167736373 GenBank AAI62588.1 188 Vascular endothelial growth factor Aa [Danio rerio]
GI:167736373 GenBank AAI62258.1 188 Vascular endothelial growth factor Aa [Danio rerio]
GI:167736373 RefSeq NP_571483.1 188 vascular endothelial growth factor A-A isoform 1 precursor [Danio rerio]
GI:18859545 RefSeq NP_001103819.2 144 vascular endothelial growth factor A-A isoform 2 precursor [Danio rerio]
GI:18859545 RefSeq NP_001117889.1 190 vascular endothelial growth factor precursor [Oncorhynchus mykiss]
GI:18859545 RefSeq XP_006625764.1 189 PREDICTED: vascular endothelial growth factor A-A-like isoform X1 [Lepisosteus oculatus]
GI:167736373 RefSeq XP_009290293.1 207 PREDICTED: vascular endothelial growth factor A-A isoform X1 [Danio rerio]
GI:167736373 SwissProt O73682.1 188 RecName: Full=Vascular endothelial growth factor A-A; Short=VEGF-A-A; Flags: Precursor [Danio rerio]