Gene/Proteome Database (LMPD)

LMPD ID
LMP011526
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
Niemann-Pick disease, type C2
Gene Symbol
Synonyms
cb292; sb:cb292
Alternate Names
epididymal secretory protein E1; 16.5 kDa secretory protein; niemann Pick type C2 protein homolog
Chromosome
17

Proteins

epididymal secretory protein E1 precursor
Refseq ID NP_775331
Protein GI 27545197
UniProt ID Q9DGJ3
mRNA ID NM_173224
Length 149
RefSeq Status PROVISIONAL
MDYRVLGVVLLSFLAYTCADPVKFVDCGSVDGKVVQVDIKPCSQQPCKLHKGQSYTVNVTFSSGVESQTSKAVVHGVLAGVPVPFPIPIDDGCKSGIQCPIVPQKPYNYVTELPVKTEYPAIKVVVEWELRDDSSKDLFCIKFPVQIVN

Gene Information

Entrez Gene ID
Gene Name
Niemann-Pick disease, type C2
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0008203 IEA:UniProtKB-KW P cholesterol metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
dre04142 Lysosome
ko04142 Lysosome

Domain Information

InterPro Annotations

Accession Description
IPR014756 Immunoglobulin E-set
IPR003172 MD-2-related lipid-recognition domain

UniProt Annotations

Entry Information

Gene Name
Niemann-Pick disease, type C2
Protein Entry
NPC2_DANRE
UniProt ID
Species
Zebrafish

Comments

Comment Type Description
Function Intracellular cholesterol transporter which acts in concert with NPC1 and plays an important role in the egress of cholesterol from the endosomal/lysosomal compartment. {ECO:0000250}.
Similarity Belongs to the NPC2 family. {ECO:0000305}.
Subcellular Location Secreted. Endoplasmic reticulum {ECO:0000250}.
Subunit Interacts with NUS1/NgBR, the interaction stabilizes NCP2 and regulates cholesterol trafficking. Interacts with DHDDS (By similarity). {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011526 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
27545197 RefSeq NP_775331 149 epididymal secretory protein E1 precursor

Identical Sequences to LMP011526 proteins

Reference Database Accession Length Protein Name
GI:27545197 GenBank AAF99719.1 149 16.5 kDa secretory protein [Danio rerio]
GI:27545197 GenBank AAH45895.1 149 Npc2 protein [Danio rerio]
GI:27545197 SwissProt Q9DGJ3.1 149 RecName: Full=Epididymal secretory protein E1; AltName: Full=16.5 kDa secretory protein; AltName: Full=Niemann Pick type C2 protein homolog; Flags: Precursor [Danio rerio]

Related Sequences to LMP011526 proteins

Reference Database Accession Length Protein Name
GI:27545197 GenBank AAI62187.1 149 Similar to Epididymal secretory protein E1 precursor (Niemann Pick type C2 protein homolog) (16.5 kDa secretory protein) [Danio rerio]
GI:27545197 GenBank AAI62195.1 149 Similar to Epididymal secretory protein E1 precursor (Niemann Pick type C2 protein homolog) (16.5 kDa secretory protein) [Danio rerio]
GI:27545197 GenBank ACN10132.1 150 Epididymal secretory protein E1 precursor [Salmo salar]
GI:27545197 RefSeq NP_001122191.1 149 epididymal secretory protein E1 precursor [Danio rerio]
GI:27545197 RefSeq NP_001134062.1 150 epididymal secretory protein E1 precursor [Salmo salar]
GI:27545197 RefSeq XP_007252570.1 149 PREDICTED: epididymal secretory protein E1-like [Astyanax mexicanus]