Gene/Proteome Database (LMPD)
Proteins
purpurin precursor | |
---|---|
Refseq ID | NP_956259 |
Protein GI | 41152371 |
UniProt ID | Q6PC07 |
mRNA ID | NM_199965 |
Length | 196 |
RefSeq Status | PROVISIONAL |
MGFYKFALLVVFLSYIERCFSASCAVESFTVKDDFDPKRYAGKWYAQQKKDPEGLFLQDNISAEYTIDDDGTMTASSKGRVTLFGFWVVCADMAAQYSVPDPTTPAKMFMNYQGLASYLSSGGDNYWVIDTDYDNYAITYACRTLKDDGSCDDGYSLVFSRNPRGLPPAIQRLVRQKQDEICMAGQFQPVLQSGAC |
Gene Information
Entrez Gene ID
Gene Name
retinol binding protein 4, like
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
GO:0005501 | IEA:InterPro | F | retinoid binding |
GO:0036094 | IEA:InterPro | F | small molecule binding |
GO:0005215 | IEA:InterPro | F | transporter activity |
GO:0060041 | IMP:ZFIN | P | retina development in camera-type eye |
Domain Information
UniProt Annotations
Entry Information
Gene Name
retinol binding protein 4, like
Protein Entry
Q6PC07_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011596 (as displayed in Record Overview)
Identical Sequences to LMP011596 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:41152371 | DBBJ | BAF62293.1 | 196 | purpurin [Danio rerio] |
GI:41152371 | GenBank | AAH59516.1 | 196 | Retinol binding protein 4, like [Danio rerio] |
GI:41152371 | GenBank | AAI52211.1 | 196 | Retinol binding protein 4, like [Danio rerio] |
GI:41152371 | GenBank | AAI60959.1 | 196 | LOC100135273 protein [Xenopus (Silurana) tropicalis] |
Related Sequences to LMP011596 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:41152371 | DBBJ | BAD42450.1 | 196 | purpurin [Carassius auratus] |
GI:41152371 | GenBank | AAI52210.1 | 196 | Rbp4l protein [Danio rerio] |
GI:41152371 | GenBank | AAI57565.1 | 196 | LOC100135273 protein [Xenopus (Silurana) tropicalis] |
GI:41152371 | GenBank | ADO29372.1 | 196 | purpurin [Ictalurus punctatus] |
GI:41152371 | RefSeq | NP_001107427.1 | 196 | uncharacterized protein LOC100135273 precursor [Xenopus (Silurana) tropicalis] |
GI:41152371 | RefSeq | XP_007240920.1 | 196 | PREDICTED: purpurin-like [Astyanax mexicanus] |