Gene/Proteome Database (LMPD)
Proteins
prostaglandin D2 synthase, brain precursor | |
---|---|
Refseq ID | NP_998799 |
Protein GI | 47174758 |
UniProt ID | Q8QGV5 |
mRNA ID | NM_213634 |
Length | 184 |
RefSeq Status | PROVISIONAL |
MTSVVVKMLCLLLCAVFASADVMPMTDFDLQKVEGKWYLVGFATNAKWFVSHKDDMKMGTAMLVPTQEGDLDLSYSNLKSDGSCWRMTYLAKKTETPGRFVFYSQRWGNDNDMRVVDAKFDEYAIFHTIKTKGGVSEILNKLYSRTPEMVDDLKEKFRQFCLDTGILEENIVMLPQNGECSVAA |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
GO:0001972 | IDA:ZFIN | F | retinoic acid binding |
GO:0005215 | IEA:InterPro | F | transporter activity |
GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
prostaglandin D2 synthase b
Protein Entry
Q8QGV5_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011599 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
47174758 | RefSeq | NP_998799 | 184 | prostaglandin D2 synthase, brain precursor |
Identical Sequences to LMP011599 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:47174758 | DBBJ | BAB88223.1 | 184 | lipocalin-type prostaglandin D synthase-like protein [Danio rerio] |
GI:47174758 | GenBank | AAI16555.1 | 184 | Ptgds protein [Danio rerio] |
GI:47174758 | GenBank | AAI64970.1 | 184 | Ptgds protein [Danio rerio] |
Related Sequences to LMP011599 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:47174758 | DBBJ | BAB88224.1 | 184 | lipocalin-type prostaglandin D synthase-like protein [Danio rerio] |
GI:47174758 | DBBJ | BAC06824.1 | 184 | prostaglandin D synthase homolog [Danio rerio] |
GI:47174758 | GenBank | AAI22163.1 | 184 | Zgc:153154 [Danio rerio] |
GI:47174758 | GenBank | AAI29438.1 | 227 | Zgc:158768 [Danio rerio] |
GI:47174758 | RefSeq | NP_001038878.1 | 184 | lipocalin-15 precursor [Danio rerio] |
GI:47174758 | RefSeq | XP_003443553.1 | 183 | PREDICTED: lipocalin-like [Oreochromis niloticus] |