Gene/Proteome Database (LMPD)
LMPD ID
LMP011602
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
cholesterol 25-hydroxylase like 1, tandem duplicate 1
Gene Symbol
Synonyms
Ch25h; fa92a08; wu:fa92a08; zgc:110696; si:dkey-24l11.8
Alternate Names
cholesterol 25-hydroxylase-like protein 1, member 1; cholesterol 25-hydroxylase like 1, member 1
Chromosome
18
EC Number
1.14.99.-
Proteins
cholesterol 25-hydroxylase-like protein 1, member 1 | |
---|---|
Refseq ID | NP_001017865 |
Protein GI | 62955703 |
UniProt ID | Q567X1 |
mRNA ID | NM_001017865 |
Length | 282 |
RefSeq Status | PROVISIONAL |
MWNISEVVFQLPTSSASDRLLQPLWDYLLLRHYTLISSPFFPVLLAFSSYIIFSVPFAVLDVLGEKAPLFKYKIQKDRSPTVGMMLRTLWTAVYNHLVFVLPAVLITNMVMPMPPLPTVAPTVWEMFSGGLGALLVFDTQYFLWHMVHHKNPHLYRWVHAIHHDYISPFSWSTQHLSGVELMTVGFWSNIDPILLKCHPLTVWTLTVYSIWMSVEDHIGYDLPFSPGHLVPFGLLGGAMAHDMHHQKPSSNFAPFFSHWDKIFGTAITVKLTQKSEKEKQVA |
Gene Information
Entrez Gene ID
Gene Name
cholesterol 25-hydroxylase like 1, tandem duplicate 1
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0004497 | IEA:UniProtKB-KW | F | monooxygenase activity |
GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
GO:0016126 | IEA:UniProtKB-KW | P | sterol biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
dre00120 | Primary bile acid biosynthesis |
ko00120 | Primary bile acid biosynthesis |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Gene Name
cholesterol 25-hydroxylase like 1, tandem duplicate 1
Protein Entry
C25L1_DANRE
UniProt ID
Species
Zebrafish
Comments
Comment Type | Description |
---|---|
Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
Function | May catalyze the formation of 25-hydroxycholesterol from cholesterol. {ECO:0000250}. |
Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011602 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
62955703 | RefSeq | NP_001017865 | 282 | cholesterol 25-hydroxylase-like protein 1, member 1 |
Identical Sequences to LMP011602 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:62955703 | GenBank | AAH92984.1 | 282 | Si:dkey-24l11.8 [Danio rerio] |
Related Sequences to LMP011602 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:62955703 | RefSeq | XP_005798337.1 | 276 | PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1-like [Xiphophorus maculatus] |
GI:62955703 | RefSeq | XP_007235744.1 | 284 | PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1-like [Astyanax mexicanus] |
GI:62955703 | RefSeq | XP_007566487.1 | 276 | PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1 [Poecilia formosa] |
GI:62955703 | RefSeq | XP_008280331.1 | 277 | PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1 [Stegastes partitus] |
GI:62955703 | RefSeq | XP_008410536.1 | 276 | PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1 [Poecilia reticulata] |
GI:62955703 | SwissProt | Q567X1.2 | 282 | RecName: Full=Cholesterol 25-hydroxylase-like protein 1, member 1 [Danio rerio] |