Gene/Proteome Database (LMPD)

LMPD ID
LMP011602
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
cholesterol 25-hydroxylase like 1, tandem duplicate 1
Gene Symbol
Synonyms
Ch25h; fa92a08; wu:fa92a08; zgc:110696; si:dkey-24l11.8
Alternate Names
cholesterol 25-hydroxylase-like protein 1, member 1; cholesterol 25-hydroxylase like 1, member 1
Chromosome
18
EC Number
1.14.99.-

Proteins

cholesterol 25-hydroxylase-like protein 1, member 1
Refseq ID NP_001017865
Protein GI 62955703
UniProt ID Q567X1
mRNA ID NM_001017865
Length 282
RefSeq Status PROVISIONAL
MWNISEVVFQLPTSSASDRLLQPLWDYLLLRHYTLISSPFFPVLLAFSSYIIFSVPFAVLDVLGEKAPLFKYKIQKDRSPTVGMMLRTLWTAVYNHLVFVLPAVLITNMVMPMPPLPTVAPTVWEMFSGGLGALLVFDTQYFLWHMVHHKNPHLYRWVHAIHHDYISPFSWSTQHLSGVELMTVGFWSNIDPILLKCHPLTVWTLTVYSIWMSVEDHIGYDLPFSPGHLVPFGLLGGAMAHDMHHQKPSSNFAPFFSHWDKIFGTAITVKLTQKSEKEKQVA

Gene Information

Entrez Gene ID
Gene Name
cholesterol 25-hydroxylase like 1, tandem duplicate 1
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005506 IEA:InterPro F iron ion binding
GO:0004497 IEA:UniProtKB-KW F monooxygenase activity
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0016126 IEA:UniProtKB-KW P sterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
dre00120 Primary bile acid biosynthesis
ko00120 Primary bile acid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
6176066 Bile acid and bile salt metabolism
6176269 Synthesis of bile acids and bile salts

Domain Information

InterPro Annotations

Accession Description
IPR006694 Fatty_acid_hydroxylase

UniProt Annotations

Entry Information

Gene Name
cholesterol 25-hydroxylase like 1, tandem duplicate 1
Protein Entry
C25L1_DANRE
UniProt ID
Species
Zebrafish

Comments

Comment Type Description
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250};
Function May catalyze the formation of 25-hydroxycholesterol from cholesterol. {ECO:0000250}.
Similarity Belongs to the sterol desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011602 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
62955703 RefSeq NP_001017865 282 cholesterol 25-hydroxylase-like protein 1, member 1

Identical Sequences to LMP011602 proteins

Reference Database Accession Length Protein Name
GI:62955703 GenBank AAH92984.1 282 Si:dkey-24l11.8 [Danio rerio]

Related Sequences to LMP011602 proteins

Reference Database Accession Length Protein Name
GI:62955703 RefSeq XP_005798337.1 276 PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1-like [Xiphophorus maculatus]
GI:62955703 RefSeq XP_007235744.1 284 PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1-like [Astyanax mexicanus]
GI:62955703 RefSeq XP_007566487.1 276 PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1 [Poecilia formosa]
GI:62955703 RefSeq XP_008280331.1 277 PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1 [Stegastes partitus]
GI:62955703 RefSeq XP_008410536.1 276 PREDICTED: cholesterol 25-hydroxylase-like protein 1, member 1 [Poecilia reticulata]
GI:62955703 SwissProt Q567X1.2 282 RecName: Full=Cholesterol 25-hydroxylase-like protein 1, member 1 [Danio rerio]