Gene/Proteome Database (LMPD)
Proteins
| membrane progestin receptor beta | |
|---|---|
| Refseq ID | NP_899187 |
| Protein GI | 34330180 |
| UniProt ID | Q801G3 |
| mRNA ID | NM_183344 |
| Length | 352 |
| RefSeq Status | PROVISIONAL |
| MSSGVLGRLSTLTLSLQQLGQLPHLSNWLPRLPRRQATVHASEVPSLFREPYILSGYRPVHQEWRSYFCSLFQCHNELLNVWTHLLAIPAVLLQFSFFAGAWGLTLNLASLPLFLYVLSSLTYLSFSVAAHLLQSHSELAHYSLFFVDYVGVAVYQYGCSMGHYFYCSEPEWRHSLVGVLFLPGAAMLAWLSCASCCYSKFRYRRPYPFHRKICQIIPTSLAYLLDISPVAHRLLTKSWDEPVLVFHAMQVAFFLLAALFFSCPVPERFFPGRCDIVGHGHQIFHIFLVLCTMCQLEAMFRDFLVHQQSVVDAHGEHFILLAGGSFFLLVLCSILTAVLMRGAVQRQLRKKD | |
Gene Information
Entrez Gene ID
Gene Name
progestin and adipoQ receptor family member VIII
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:InterPro | C | integral component of membrane |
| GO:0005886 | IDA:ZFIN | C | plasma membrane |
| GO:0005496 | IDA:ZFIN | F | steroid binding |
| GO:0003707 | IBA:RefGenome | F | steroid hormone receptor activity |
| GO:0048545 | IDA:ZFIN | P | response to steroid hormone |
| GO:0007165 | IDA:ZFIN | P | signal transduction |
| GO:0043401 | IBA:GOC | P | steroid hormone mediated signaling pathway |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR004254 | AdipoR/Haemolysin-III-related |
UniProt Annotations
Entry Information
Gene Name
progestin and adipoQ receptor family member VIII
Protein Entry
Q801G3_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011619 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 34330180 | RefSeq | NP_899187 | 352 | membrane progestin receptor beta |
Identical Sequences to LMP011619 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:34330180 | GenBank | AAN78114.1 | 352 | membrane progestin receptor beta [Danio rerio] |
| GI:34330180 | RefSeq | XP_009292975.1 | 352 | PREDICTED: membrane progestin receptor beta isoform X1 [Danio rerio] |
Related Sequences to LMP011619 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:34330180 | DBBJ | BAF37034.1 | 352 | membrane progestin receptor beta [Carassius auratus] |
| GI:34330180 | GenBank | AAH92682.1 | 352 | Progestin and adipoQ receptor family member VIII [Danio rerio] |
| GI:34330180 | GenBank | AAI64168.1 | 352 | Paqr8 protein [Danio rerio] |
| GI:34330180 | GenBank | AFM74476.1 | 354 | membrane progesterone receptor beta [Pimephales promelas] |
| GI:34330180 | RefSeq | NP_001187119.1 | 356 | putative membrane progestin receptor beta [Ictalurus punctatus] |
| GI:34330180 | RefSeq | XP_007245411.1 | 352 | PREDICTED: membrane progestin receptor beta [Astyanax mexicanus] |