Gene/Proteome Database (LMPD)
Proteins
| very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase | |
|---|---|
| Refseq ID | NP_001038449 |
| Protein GI | 113678933 |
| UniProt ID | Q7SY06 |
| mRNA ID | NM_001044984 |
| Length | 359 |
| RefSeq Status | PROVISIONAL |
| MSALTPHVYWAQRHGEIYLRVEISDAQDLSIGVEENILQFRGQGHGAKGENEYEFSLEFLKPVKPEVKHKSTQRQVNITVRKQEEVWWNRLTKQEKKPLFLAPDFDRWLDESDAEMELREKEEKINKVSFESRVRKDPFLGLKKGFLFMYNLVQFLGYSWIFVNMTVRLFILGQDSFYDTFHTIADVMYFCQMLAIMEVINPAVGLVKTGVMPAFIQVMGRNFILFVIFGSLEDMQNKPVVFFVFYLWSTIEIFRYPFYMLACIDTEWKLLTWLRYTIWMPLYPLGVLAEAVAVIQSIPIFDETKLLSIPLPKATGLSLSFSYILQLYLVVMFLGLFINFRHLFKQRTRRFRTKKRKAN | |
Gene Information
Entrez Gene ID
Gene Name
protein tyrosine phosphatase-like A domain containing 1
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016829 | IEA:UniProtKB-KW | F | lyase activity |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
protein tyrosine phosphatase-like A domain containing 1
Protein Entry
HADC_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain (3R)-3-hydroxyacyl-CoA = a very-long-chain trans-2,3-dehydroacyl-CoA + H(2)O. |
| Function | Responsible for the dehydration step in very long-chain fatty acid (VLCFA) synthesis. Involved in Rac1-signaling pathways leading to the modulation of gene expression (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the very long-chain fatty acids dehydratase HACD family. {ECO:0000305}. |
| Similarity | Contains 1 CS domain. {ECO:0000255|PROSITE- ProRule:PRU00547}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011667 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 113678933 | RefSeq | NP_001038449 | 359 | very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase |
Identical Sequences to LMP011667 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:113678933 | GenBank | AAI62805.1 | 359 | Protein tyrosine phosphatase-like A domain containing 1 [Danio rerio] |
| GI:113678933 | GenBank | AAI62443.1 | 359 | Protein tyrosine phosphatase-like A domain containing 1 [Danio rerio] |
| GI:113678933 | SwissProt | Q7SY06.2 | 359 | RecName: Full=Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase; AltName: Full=3-hydroxyacyl-CoA dehydratase; Short=HACD; AltName: Full=Protein tyrosine phosphatase-like protein ptplad1; AltName: Full=Protein-tyrosine phosphatase-like A domain-containing protein 1 [Danio rerio] |
Related Sequences to LMP011667 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:113678933 | EMBL | CAQ13580.1 | 404 | novel protein (zgc:63632) [Danio rerio] |
| GI:113678933 | GenBank | AAH55174.1 | 359 | Protein tyrosine phosphatase-like A domain containing 1 [Danio rerio] |
| GI:113678933 | RefSeq | XP_006628793.1 | 360 | PREDICTED: very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase-like [Lepisosteus oculatus] |
| GI:113678933 | RefSeq | XP_007249225.1 | 359 | PREDICTED: very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase-like [Astyanax mexicanus] |
| GI:113678933 | RefSeq | XP_008293099.1 | 361 | PREDICTED: very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase-like [Stegastes partitus] |
| GI:113678933 | RefSeq | XP_008335191.1 | 361 | PREDICTED: very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 3 [Cynoglossus semilaevis] |