Gene/Proteome Database (LMPD)
Proteins
| lactosylceramide alpha-2,3-sialyltransferase | |
|---|---|
| Refseq ID | NP_955810 |
| Protein GI | 117606180 |
| UniProt ID | A0JMC3 |
| mRNA ID | NM_199516 |
| Length | 364 |
| RefSeq Status | PROVISIONAL |
| MRRVMKQSSCYFSKRTMILLLSLALMSLAFLKLPSFHTELKPVEVPVDNKFRKRVHSHVREILDKECRPSFARQRMVTEHHGSTPTIDPFLNKNMKLDKQIFQYPPPFGFLDMKNKLEEILNLLPVSSEQRLGERDCRRCVVVGNGGILKGLGLGHLLNRFDIIIRLNSGPLQDFSADVGNRTTIRMSYPESCPKVWEDTDPDLKYVAVIFKSVDFHWLRAMISRTPVSLWDRLFFWQNVPMSVPVKTSQFHLLNPQIIREMALDLLNYPEPKKRLWSWDQNIPTLGLTALNLATYICDEVSLAGFGYNLSQKEAPLHYYDSVPMTTILKEAMHNVQKETVFLKRLVASGSITDLTGGIHCSFC | |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0008373 | IEA:InterPro | F | sialyltransferase activity |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Protein Entry
A0JMC3_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011713 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 117606180 | RefSeq | NP_955810 | 364 | lactosylceramide alpha-2,3-sialyltransferase |
Identical Sequences to LMP011713 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:117606180 | GenBank | AAI25823.1 | 364 | ST3 beta-galactoside alpha-2,3-sialyltransferase 5 [Danio rerio] |
| GI:117606180 | GenBank | AAI64193.1 | 364 | St3gal5 protein [Danio rerio] |
Related Sequences to LMP011713 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:117606180 | EMBL | CAF04061.1 | 364 | ganglioside GM3 synthase [Danio rerio] |
| GI:117606180 | EMBL | CAG29188.1 | 364 | alpha-2,3-sialyltransferase [Danio rerio] |
| GI:117606180 | GenBank | AGD02010.1 | 364 | Sequence 41 from patent US 8338154 |
| GI:117606180 | GenBank | AHH39684.1 | 379 | Lactosylceramide alpha-2,3-sialyltransferase [Ictalurus punctatus] |
| GI:117606180 | RefSeq | XP_005157196.1 | 364 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase isoform X1 [Danio rerio] |
| GI:117606180 | RefSeq | XP_007236529.1 | 388 | PREDICTED: lactosylceramide alpha-2,3-sialyltransferase-like isoform X2 [Astyanax mexicanus] |