Gene/Proteome Database (LMPD)
Proteins
| 1-acyl-sn-glycerol-3-phosphate acyltransferase delta | |
|---|---|
| Refseq ID | NP_998157 |
| Protein GI | 47085691 |
| UniProt ID | Q6PGY2 |
| mRNA ID | NM_212992 |
| Length | 377 |
| RefSeq Status | PROVISIONAL |
| MGLLKVLKTQLLCHLIICYVFLVSGIIINLLQLCTLPLWPINKQLARKINCRLGYSIASQLVALLEWWSGTECTLYTDPESFRLYGKENAIVVLNHNFEIDFMTGWTFCERFGVLGSSKVLAKKELSFVPVIGWMWYFLEIVFCKRKWEEDRNTVVQSLRNLQDYPEFFWFLLHCEGTRFTEKKHKISMEVAEKKGLPKLKYHLLPRTKGFCVTVQNLRGKVTAVYDSTLNFRNNEMPTLLGVLNGKKYHADLYVRRIPLDSIPEDESECAAWLHKLYQEKDEFQEHYRQTGRFPGPITNPPRRLWALVNWLFWVCVLVYPICVLLLQLLLSGSTFTIVCTFVFCLAVSAGVRWMIGQTEIDKGSNYGVKDVQMNNN | |
Gene Information
Entrez Gene ID
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta)
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016746 | IEA:UniProtKB-KW | F | transferase activity, transferring acyl groups |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002123 | Phospholipid/glycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta)
Protein Entry
Q6PGY2_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011744 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 47085691 | RefSeq | NP_998157 | 377 | 1-acyl-sn-glycerol-3-phosphate acyltransferase delta |
Identical Sequences to LMP011744 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47085691 | GenBank | AAH56788.1 | 377 | 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Danio rerio] |
Related Sequences to LMP011744 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47085691 | GenBank | AHH42602.1 | 427 | 1-acyl-sn-glycerol-3-phosphate acyltransferase delta [Ictalurus punctatus] |
| GI:47085691 | RefSeq | XP_003964149.1 | 377 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta-like [Takifugu rubripes] |
| GI:47085691 | RefSeq | XP_007231299.1 | 381 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta isoform X1 [Astyanax mexicanus] |
| GI:47085691 | RefSeq | XP_007546256.1 | 377 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta [Poecilia formosa] |
| GI:47085691 | RefSeq | XP_008428104.1 | 377 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta [Poecilia reticulata] |
| GI:47085691 | RefSeq | XP_008428105.1 | 377 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta [Poecilia reticulata] |