Gene/Proteome Database (LMPD)
Proteins
| geranylgeranyl transferase type-2 subunit beta | |
|---|---|
| Refseq ID | NP_998277 |
| Protein GI | 76253908 |
| UniProt ID | Q4V946 |
| mRNA ID | NM_213112 |
| Length | 331 |
| RefSeq Status | PROVISIONAL |
| MGTQVKDVTIKPDAPNTLFLDKHADYIAAYGSKKDDYEYTLSEYLRMSGIYWGLTVMDLMGQLSRMNREEIIEFIKSCQHDCGGISASIGHDPHLLYTLSAIQILSLYDSVNAIDVDKVVEYVKGLQQEDGSFAGDKWGEIDTRFSFCAVATLALLGKLDVINVDKAVEFVMSCMNFDGGFGCRPGSESHAGQIYCCTGFLSVTGQLHQVNADLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRIHWIDKAKLRNFILACQDEETGGFADRPGDMVDPFHTLFGVAGLSLLGDEQIKPVNPVFCMPEDVLQRIGLQPDLLS | |
Gene Information
Entrez Gene ID
Gene Name
Rab geranylgeranyltransferase, beta subunit
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0004663 | IEA:InterPro | F | Rab geranylgeranyltransferase activity |
| GO:0018344 | IEA:InterPro | P | protein geranylgeranylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
Rab geranylgeranyltransferase, beta subunit
Protein Entry
Q4V946_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011753 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 76253908 | RefSeq | NP_998277 | 331 | geranylgeranyl transferase type-2 subunit beta |
Identical Sequences to LMP011753 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:76253908 | GenBank | AAH97066.1 | 331 | Rab geranylgeranyltransferase, beta subunit [Danio rerio] |
| GI:76253908 | GenBank | AAI64578.1 | 331 | Rabggtb protein [Danio rerio] |
Related Sequences to LMP011753 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:76253908 | RefSeq | XP_004555277.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta-like isoform X1 [Maylandia zebra] |
| GI:76253908 | RefSeq | XP_005476758.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta-like [Oreochromis niloticus] |
| GI:76253908 | RefSeq | XP_005729059.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta-like isoform X1 [Pundamilia nyererei] |
| GI:76253908 | RefSeq | XP_005924605.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta-like isoform X1 [Haplochromis burtoni] |
| GI:76253908 | RefSeq | XP_006792396.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta-like isoform X2 [Neolamprologus brichardi] |
| GI:76253908 | RefSeq | XP_008290026.1 | 331 | PREDICTED: geranylgeranyl transferase type-2 subunit beta [Stegastes partitus] |