Gene/Proteome Database (LMPD)
LMPD ID
LMP011767
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
family with sequence similarity 213, member B
Gene Symbol
Synonyms
sb:cb782; zgc:85644; wu:fc33a02
Alternate Names
prostamide/prostaglandin F synthase; prxl2; prostamide/PGF synthase; prostamide/PG F synthase
Chromosome
11
EC Number
1.11.1.20
Proteins
| prostamide/prostaglandin F synthase | |
|---|---|
| Refseq ID | NP_998478 |
| Protein GI | 47086953 |
| UniProt ID | Q6NV24 |
| mRNA ID | NM_213313 |
| Length | 201 |
| RefSeq Status | PROVISIONAL |
| MSSVNLTSLGANQLKNTTTGEMVEIGSLWREQAVVLFFLRRFGCQVCRWMAAEVSKLEKDLKAHGIALVGIGPEETGVKEFKDGGFFKGDIYIDEMKQCYKDLGFKRYNAINVVPAAMGKKVREIASKASAEGIQGNFSGDLLQSGGMLIVAKGGEKVLLHFIQKSPADNPPLEEITKALGISANVQAGEKPQCNEDVCTR | |
Gene Information
Entrez Gene ID
Gene Name
family with sequence similarity 213, member B
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0016616 | ISS:UniProtKB | F | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor |
| GO:0001516 | ISS:UniProtKB | P | prostaglandin biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR012336 | Thioredoxin-like fold |
UniProt Annotations
Entry Information
Gene Name
family with sequence similarity 213, member B
Protein Entry
PGFS_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Thioredoxin + prostaglandin H(2) = thioredoxin disulfide + prostaglandin F(2-alpha). |
| Function | Catalyzes the reduction of prostaglandin-ethanolamide H(2) (prostamide H(2)) to prostamide F(2alpha) with NADPH as proton donor. Also able to reduce prostaglandin H(2) to prostaglandin F(2alpha) (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the peroxiredoxin-like FAM213 family. Prostamide/prostaglandin F synthase subfamily. {ECO:0000305}. |
| Subcellular Location | Cytoplasm, cytosol {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011767 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 47086953 | RefSeq | NP_998478 | 201 | prostamide/prostaglandin F synthase |
Identical Sequences to LMP011767 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47086953 | GenBank | AAH68342.1 | 201 | Zgc:85644 [Danio rerio] |
| GI:47086953 | SwissProt | Q6NV24.1 | 201 | RecName: Full=Prostamide/prostaglandin F synthase; Short=Prostamide/PG F synthase; Short=Prostamide/PGF synthase [Danio rerio] |
Related Sequences to LMP011767 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47086953 | EMBL | CDQ65788.1 | 200 | unnamed protein product [Oncorhynchus mykiss] |
| GI:47086953 | GenBank | ACI67539.1 | 200 | C1orf93 homolog [Salmo salar] |
| GI:47086953 | GenBank | ADO27754.1 | 201 | uncharacterized protein c1orf93-like protein [Ictalurus furcatus] |
| GI:47086953 | RefSeq | XP_004068686.1 | 201 | PREDICTED: prostamide/prostaglandin F synthase-like [Oryzias latipes] |
| GI:47086953 | RefSeq | XP_007251504.1 | 201 | PREDICTED: prostamide/prostaglandin F synthase [Astyanax mexicanus] |
| GI:47086953 | SwissProt | B5X9L9.1 | 200 | RecName: Full=Prostamide/prostaglandin F synthase; Short=Prostamide/PG F synthase; Short=Prostamide/PGF synthase [Salmo salar] |