Gene/Proteome Database (LMPD)
Proteins
| palmitoyl-protein thioesterase 1 precursor | |
|---|---|
| Refseq ID | NP_998504 |
| Protein GI | 47086993 |
| UniProt ID | Q7T3C4 |
| mRNA ID | NM_213339 |
| Length | 303 |
| RefSeq Status | PROVISIONAL |
| MAPPAAFRLLSVSGCLLLLCGTSWASNGTVPLVIWHGMGDSCCNPLSMGAIKKMVEQEVSGIYVLSLMIGKSVFEDTENGFLMDVNKQVSFVCDQLAKDPKLKEGYNAMGFSQGAQFLRAVAQRCPDPPMRNLISVGGQHQGVYGLPRCPGESSHICDWIRKQLNSGAYTDAVQKHLVQAQYWHDPLNDDLYKKYSLFLADINQERVVNETYKKNLMSLNKFVMVKFLQDSIVDPVDSEWFGFYKAGQAEELETLQESPIYKEDRLGLAAMDSAGKLVFLASEGDHLQFTREWFNENLLSYLL | |
Gene Information
Entrez Gene ID
Gene Name
palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile)
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005764 | IBA:RefGenome | C | lysosome |
| GO:0008474 | IBA:RefGenome | F | palmitoyl-(protein) hydrolase activity |
| GO:0002084 | IBA:RefGenome | P | protein depalmitoylation |
| GO:0006898 | IBA:RefGenome | P | receptor-mediated endocytosis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile)
Protein Entry
Q7T3C4_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011771 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 47086993 | RefSeq | NP_998504 | 303 | palmitoyl-protein thioesterase 1 precursor |
Identical Sequences to LMP011771 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47086993 | GenBank | AAH53174.1 | 303 | Palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile) [Danio rerio] |
Related Sequences to LMP011771 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47086993 | GenBank | AHH39249.1 | 297 | Palmitoyl-protein thioesterase 1 [Ictalurus punctatus] |
| GI:47086993 | RefSeq | XP_005159823.1 | 303 | PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Danio rerio] |
| GI:47086993 | RefSeq | XP_005159824.1 | 303 | PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Danio rerio] |
| GI:47086993 | RefSeq | XP_007245763.1 | 314 | PREDICTED: palmitoyl-protein thioesterase 1 isoform X1 [Astyanax mexicanus] |
| GI:47086993 | RefSeq | XP_007245764.1 | 299 | PREDICTED: palmitoyl-protein thioesterase 1 isoform X2 [Astyanax mexicanus] |
| GI:47086993 | RefSeq | XP_008299740.1 | 303 | PREDICTED: palmitoyl-protein thioesterase 1 [Stegastes partitus] |