Gene/Proteome Database (LMPD)
Proteins
| methylsterol monooxygenase 1 | |
|---|---|
| Refseq ID | NP_998518 |
| Protein GI | 47087009 |
| UniProt ID | Q7ZW77 |
| mRNA ID | NM_213353 |
| Length | 291 |
| RefSeq Status | PROVISIONAL |
| MEVNGTANILSSAFLAVEFVDSFLPQNPLQEPFKHAWNHMLQNYTKFQIATWGSLIVHELIYFLFCLPGFIFQFLPFMQKYKIQPDKPETWEKQWKCFKMLLFNHFCIQLPLICGTYYFTEFFSIPYDWDTMPRWPFLLAQCFGCAVIEDTWHYFLHRALHHRRIYKYIHKVHHDFTSPFGMQAEYAHPLETLILGAGFFIGTMVFCNHMILLWAWVTFRLLETIDVHSGYDIPLNPLHLIPFYAGARFHDFHHMNFVGNYGSTFTWWDRLFDTDSQFNKHYSHHKTAKSD | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0000254 | IEA:UniProtKB-EC | F | C-4 methylsterol oxidase activity |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
| GO:0016126 | IEA:UniProtKB-KW | P | sterol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| dre_M00101 | Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol |
| dre01100 | Metabolic pathways |
| dre00100 | Steroid biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Gene Name
methylsterol monooxygenase 1
Protein Entry
MSMO1_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 3-beta-hydroxy-4-beta-methyl-5-alpha-cholest- 7-ene-4-alpha-carbaldehyde + NAD(P)H + O(2) = 3-beta-hydroxy-4- beta-methyl-5-alpha-cholest-7-ene-4-alpha-carboxylate + NAD(P)(+) + H(2)O. |
| Catalytic Activity | 4,4-dimethyl-5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)(+) + H(2)O. |
| Catalytic Activity | 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 3-beta-hydroxy-4-beta- methyl-5-alpha-cholest-7-ene-4-alpha-carbaldehyde + NAD(P)(+) + 2 H(2)O. |
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
| Pathway | Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 3/6. |
| Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011772 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 47087009 | RefSeq | NP_998518 | 291 | methylsterol monooxygenase 1 |
Identical Sequences to LMP011772 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47087009 | EMBL | CAR81296.1 | 291 | unnamed protein product [Danio rerio] |
| GI:47087009 | EMBL | CBX84774.1 | 291 | unnamed protein product [Danio rerio] |
| GI:47087009 | GenBank | AAH50163.1 | 291 | Sterol-C4-methyl oxidase-like [Danio rerio] |
| GI:47087009 | SwissProt | Q7ZW77.1 | 291 | RecName: Full=Methylsterol monooxygenase 1; AltName: Full=C-4 methylsterol oxidase [Danio rerio] |
Related Sequences to LMP011772 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47087009 | RefSeq | XP_003449736.1 | 291 | PREDICTED: methylsterol monooxygenase 1-like [Oreochromis niloticus] |
| GI:47087009 | RefSeq | XP_005936806.1 | 291 | PREDICTED: methylsterol monooxygenase 1-like [Haplochromis burtoni] |
| GI:47087009 | RefSeq | XP_006629489.1 | 291 | PREDICTED: methylsterol monooxygenase 1-like [Lepisosteus oculatus] |
| GI:47087009 | RefSeq | XP_006796151.1 | 291 | PREDICTED: methylsterol monooxygenase 1-like [Neolamprologus brichardi] |
| GI:47087009 | RefSeq | XP_008291202.1 | 291 | PREDICTED: methylsterol monooxygenase 1 [Stegastes partitus] |
| GI:47087009 | RefSeq | XP_008315683.1 | 291 | PREDICTED: methylsterol monooxygenase 1 [Cynoglossus semilaevis] |