Gene/Proteome Database (LMPD)
Proteins
| ST3 beta-galactoside alpha-2,3-sialyltransferase 3b | |
|---|---|
| Refseq ID | NP_999950 |
| Protein GI | 47550865 |
| UniProt ID | Q702R8 |
| mRNA ID | NM_214785 |
| Length | 355 |
| RefSeq Status | PROVISIONAL |
| MKPAHKLLFVVCPMLVLGFIYYSSGKLHLHVWGQKPLFDKQGFMLNLDTKLPLDLAYKYGNLSEGACKPGYAAAKMTAIYPKSKPASMFLDRNFKRLAKVINYLPPFGFRTQERIIDVILSATKNYGLGPELDSLICKRCIIVGNGGILSNKSLGSRIDEYDVVVRLNEAPVSGYTRDVGSKTTMRITYPEGAIQKPERYEKDSLFVFSAFKPLDFKWLRQMVYKEKLVRLEGFWKSVARYVPREPSEIRILNPYFIQEAAFQFIGLPQNNGLMGKGNIPTLGTVAITMALHNCDEVAVAGFGYDMNTPHAPLHYYESVKMSAIKESWTHNISKEKEFLRKLVKANIITDLTNGI | |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 3b
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0008373 | IEA:InterPro | F | sialyltransferase activity |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 3b
Protein Entry
Q702R8_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011787 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 47550865 | RefSeq | NP_999950 | 355 | ST3 beta-galactoside alpha-2,3-sialyltransferase 3b |
Identical Sequences to LMP011787 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47550865 | EMBL | CAF25179.1 | 355 | alpha-2,3-sialyltransferase ST3Gal III [Danio rerio] |
| GI:47550865 | EMBL | CAG29186.1 | 355 | alpha-2,3-sialyltransferase [Danio rerio] |
Related Sequences to LMP011787 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47550865 | RefSeq | XP_005163396.1 | 372 | PREDICTED: ST3 beta-galactoside alpha-2,3-sialyltransferase 3b isoform X2 [Danio rerio] |
| GI:47550865 | RefSeq | XP_005163397.1 | 356 | PREDICTED: ST3 beta-galactoside alpha-2,3-sialyltransferase 3b isoform X3 [Danio rerio] |
| GI:47550865 | RefSeq | XP_009296727.1 | 396 | PREDICTED: ST3 beta-galactoside alpha-2,3-sialyltransferase 3b isoform X1 [Danio rerio] |
| GI:47550865 | RefSeq | XP_009296728.1 | 396 | PREDICTED: ST3 beta-galactoside alpha-2,3-sialyltransferase 3b isoform X1 [Danio rerio] |
| GI:47550865 | RefSeq | XP_009296729.1 | 396 | PREDICTED: ST3 beta-galactoside alpha-2,3-sialyltransferase 3b isoform X1 [Danio rerio] |
| GI:47550865 | RefSeq | XP_009296730.1 | 396 | PREDICTED: ST3 beta-galactoside alpha-2,3-sialyltransferase 3b isoform X1 [Danio rerio] |