Gene/Proteome Database (LMPD)
Proteins
| cellular retinoic acid binding protein 1b | |
|---|---|
| Refseq ID | NP_001001842 |
| Protein GI | 49227631 |
| UniProt ID | Q6IWJ1 |
| mRNA ID | NM_001001842 |
| Length | 137 |
| RefSeq Status | PROVISIONAL |
| MPNFAGTWKMKSSENFEELLKALGVNAMLRKVACAAASKPHVEIRQNGEQFYIKTSTTVRTTEINFQIGQEFYEETVDGRKCKSLATWETENKMTCRQTLLDGNGPKTYWTRELRGNELILMFGADDVVCTRIYVRE | |
Gene Information
Entrez Gene ID
Gene Name
cellular retinoic acid binding protein 1b
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008289 | IEA:InterPro | F | lipid binding |
| GO:0005215 | IEA:InterPro | F | transporter activity |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cellular retinoic acid binding protein 1b
Protein Entry
Q6IWJ1_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011793 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 49227631 | RefSeq | NP_001001842 | 137 | cellular retinoic acid binding protein 1b |
Identical Sequences to LMP011793 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:49227631 | GenBank | AAT38218.1 | 137 | cellular retinoic acid-binding protein type I [Danio rerio] |
| GI:49227631 | GenBank | AAI62180.1 | 137 | Cellular retinoic acid binding protein 1b [Danio rerio] |
| GI:49227631 | GenBank | AAI62190.1 | 137 | Cellular retinoic acid binding protein 1b [Danio rerio] |
Related Sequences to LMP011793 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:49227631 | EMBL | CDQ58487.1 | 137 | unnamed protein product [Oncorhynchus mykiss] |
| GI:49227631 | GenBank | ACO14331.1 | 139 | Cellular retinoic acid-binding protein 1 [Esox lucius] |
| GI:49227631 | GenBank | ADO28781.1 | 137 | cellular retinoic acid-binding protein 1 [Ictalurus punctatus] |
| GI:49227631 | GenBank | AGH92515.1 | 137 | cellular retinoic acid-binding protein 1-like protein [Salmo salar] |
| GI:49227631 | RefSeq | NP_001187534.1 | 137 | cellular retinoic acid-binding protein 1 [Ictalurus punctatus] |
| GI:49227631 | RefSeq | NP_001266048.1 | 137 | cellular retinoic acid-binding protein 1-like protein [Salmo salar] |