Gene/Proteome Database (LMPD)

LMPD ID
LMP011812
Gene ID
436629
Species
Danio rerio (Zebrafish)
Gene Name
nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae)
Gene Symbol
nus1
Synonyms
fc21g03; zgc:92136; wu:fc21g03
Alternate Names
dehydrodolichyl diphosphate syntase complex subunit nus1; ngBR; nogo-B receptor; di-trans,poly-cis-decaprenylcistransferase
Chromosome
20
EC Number
2.5.1.87

Proteins

dehydrodolichyl diphosphate syntase complex subunit nus1
Refseq ID NP_001002356
Protein GI 50539772
UniProt ID Q6DHR8
mRNA ID NM_001002356
Length 274
RefSeq Status PROVISIONAL
MASLYEMVWRFLHALLYLQRAIVAWFRVHIWRWKLAVVDLLLPLALGFHNQKKTGPKGTRTSRRVRWGADGRTLEKLPLHVGLLVTEEEIHYTDIANLVVWCMAVGISYVSVYDNQGVFKRNNSRLMEEILKQQQELLGMGSSKYSVEILKNGTNKQEHQVLSCQSMVKVLSPDDGRLSIVQAAQQLCRAVEQKEKTSKDINVSVLDSLLKESKNIPDPDLVLKFGTVQSTLGFLPWHIRLTEIISMPSHIDASYDDLYDALQRFAGCEQRLGK

Gene Information

Entrez Gene ID
436629
Gene Name
nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae)
Gene Symbol
nus1
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016765 IEA:InterPro F transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation
GO:0002040 IMP:ZFIN P sprouting angiogenesis

Domain Information

InterPro Annotations

Accession Description
IPR001441 Decaprenyl diphosphate synthase-like

UniProt Annotations

Entry Information

Gene Name
nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae)
Protein Entry
NGBR_DANRE
UniProt ID
Q6DHR8
Species
Zebrafish

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q6DHR8-1; Sequence=Displayed; Note=No experimental confirmation available.; Name=2; IsoId=Q6DHR8-2; Sequence=VSP_034839; Note=No experimental confirmation available.;
Catalytic Activity (2E,6E)-farnesyl diphosphate + n isopentenyl diphosphate = n diphosphate + ditrans,polycis-polyprenyl diphosphate (n = 10-55). {ECO:0000250|UniProtKB:Q96E22}.
Function With DHDDS, forms the dehydrodolichyl diphosphate syntase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precusrosor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol. Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator. {ECO:0000250|UniProtKB:Q96E22}.
Miscellaneous Nus1 seems to exist in two topological orientations, a minor glycosylated species with its C-terminus oriented towards the lumen regulating NPC2 stability, and a major fraction oriented with its C-terminus directed towards the cytosol where it regulates cis-IPTase activity. {ECO:0000250|UniProtKB:Q96E22}.
Pathway Protein modification; protein glycosylation. {ECO:0000305}.
Sequence Caution Sequence=CAQ13477.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the UPP synthase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q96E22}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q96E22}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011812 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
50539772 RefSeq NP_001002356 274 dehydrodolichyl diphosphate syntase complex subunit nus1

Identical Sequences to LMP011812 proteins

Reference Database Accession Length Protein Name
GI:50539772 GenBank AAH75899.1 274 Zgc:92136 [Danio rerio]
GI:50539772 SwissProt Q6DHR8.1 274 RecName: Full=Dehydrodolichyl diphosphate syntase complex subunit nus1; AltName: Full=Di-trans,poly-cis-decaprenylcistransferase; AltName: Full=Nogo-B receptor; Short=NgBR; AltName: Full=Nuclear undecaprenyl pyrophosphate synthase 1 homolog [Danio rerio]

Related Sequences to LMP011812 proteins

Reference Database Accession Length Protein Name
GI:50539772 EMBL CDQ75418.1 281 unnamed protein product [Oncorhynchus mykiss]
GI:50539772 EMBL CDQ57442.1 281 unnamed protein product [Oncorhynchus mykiss]
GI:50539772 GenBank ACI32888.1 281 Nogo-B receptor precursor [Salmo salar]
GI:50539772 GenBank AHH39818.1 279 Nogo-B receptor [Ictalurus punctatus]
GI:50539772 RefSeq NP_001133241.1 281 Nogo-B receptor [Salmo salar]
GI:50539772 RefSeq XP_007255434.1 269 PREDICTED: nogo-B receptor [Astyanax mexicanus]