Gene/Proteome Database (LMPD)
Proteins
| zgc:92749 | |
|---|---|
| Refseq ID | NP_001002570 |
| Protein GI | 50540206 |
| UniProt ID | Q6DGW0 |
| mRNA ID | NM_001002570 |
| Length | 266 |
| RefSeq Status | PROVISIONAL |
| MNGSLSAFAFERQFDDRGALLWFQQNWGYSFVLSGTYAVLIFLGHMFMKDRQKLDLRAPLVLWSMSLAVFSIVGTLRTGWYMFNVVCSEGFRQSVCDTDFYSAPVSKFWAFAFAISKAPELGDTVFVVLRKQRLIFLHWYHHITVLLYSWFSYKDHVAGGGWFMSMNFTVHAFMYSYYTAKAAGVRVPRAFAMLITVLQISQMAAGLTVLGLVYSWKHEQHCKSTDNNIIFGSAMYFSYLPLFCAFFYQSYIRRSDGGQKRRLKRD | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
| Similarity | Belongs to the ELO family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011821 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 50540206 | RefSeq | NP_001002570 | 266 | zgc:92749 |
Identical Sequences to LMP011821 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50540206 | GenBank | AAH76227.1 | 266 | Zgc:92749 [Danio rerio] |
Related Sequences to LMP011821 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50540206 | EMBL | CDQ87920.1 | 269 | unnamed protein product [Oncorhynchus mykiss] |
| GI:50540206 | GenBank | AAH95172.1 | 266 | Zgc:92749 [Danio rerio] |
| GI:50540206 | GenBank | AAI64609.1 | 266 | Zgc:92749 protein [Danio rerio] |
| GI:50540206 | RefSeq | XP_003448760.1 | 270 | PREDICTED: elongation of very long chain fatty acids protein 6-like [Oreochromis niloticus] |
| GI:50540206 | RefSeq | XP_004565948.1 | 270 | PREDICTED: elongation of very long chain fatty acids protein 6-like [Maylandia zebra] |
| GI:50540206 | RefSeq | XP_008291851.1 | 270 | PREDICTED: elongation of very long chain fatty acids protein 6-like [Stegastes partitus] |